Diaphorina citri psyllid: psy6350


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MDLVPDNYGGYMPPPSNTHNGYYHYNNGGFVMPPGPSPTRPAIPTSVIQAAATSSHDDLYFLELGFQQRVKKKIRRVKSEGTPGTGAKRKSREDREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKCTQKQTATRDVPLVFSSIMGHVLTSVIGTITNEAS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHccccccccccccHHHHHHHcccccccccCEEEEccccEEEEEccHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccEEEEECccccHHHHcccccHHHHHHccccccc
***VPDN*************GYYHYNNGGFV***********************SHDDLYFLELGFQQ************************EDREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKCTQKQTATRDVPLVFSSIMGHVLTSVIGTI*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLVPDNYGGYMPPPSNTHNGYYHYNNGGFVMPPGPSPTRPAIPTSVIQAAATSSHDDLYFLELGFQQRVKKKIRRVKSEGTPGTGAKRKSREDREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKCTQKQTATRDVPLVFSSIMGHVLTSVIGTITNEAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ecdysone-induced protein 74EF isoform A confidentP20105

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0001077 [MF]RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcriptionprobableGO:0003700, GO:0001228, GO:0003674, GO:0001071, GO:0000982, GO:0000981

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GVJ, chain A
Confidence level:very confident
Coverage over the Query: 79-180
View the alignment between query and template
View the model in PyMOL