Psyllid ID: psy6350

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------19
MDLVPDNYGGYMPPPSNTHNGYYHYNNGGFVMPPGPSPTRPAIPTSVIQAAATSSHDDLYFLELGFQQRVKKKIRRVKSEGTPGTGAKRKSREDREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKCTQKQTATRDVPLVFSSIMGHVLTSVIGTITNEAS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHcccccccccccHHHHHHHHHccccccccEEEEEccccEEEEEccHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccccccEEEEEEccccHHHHcccccHHHHHHccccccc
ccccccccccccccccccccccEEccccccccccccccccccccccEEccccccccccHHHHccccccccccccccccccccccccccccccccccccccEcEEEEccccEEEcccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccccEEEEEccccEEEHHHHHHHHHEHHHHEccccc
mdlvpdnyggympppsnthngyyhynnggfvmppgpsptrpaiptsVIQAAATSSHDDLYFLELGFQQRVKKKIRRvksegtpgtgakrksredreycpryikwtnrergvfklVDSKAVSrlwglhknkpdmnyeTMGRALRSSVVLTRLRtkctqkqtatrdvpLVFSSIMGHVLTSVIGTITNEAS
MDLVPDNYGGYMPPPSNTHNGYYHYNNGGFVMPPGPSPTRPAIPTSVIQAAATSSHDDLYFLELGFQQRvkkkirrvksegtpgtgakrksredreycpryikwtnrergvfklvdskavsrlwglhknkpdmnyetMGRALRSSVVLTRLrtkctqkqtatrdvplvfSSIMGHVLTSVIGTITNEAS
MDLVPDNYGGYMPPPSNThngyyhynnggFVMPPGPSPTRPAIPTSVIQAAATSSHDDLYFLELGFQQrvkkkirrvkSEGTPGTGAKRKSREDREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKCTQKQTATRDVPLVFSSIMGHVLTSVIGTITNEAS
********************GYYHYNNGGFV***********************SHDDLYFLELGFQQRV**************************YCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKCTQKQTATRDVPLVFSSIMGHVLTSVIGTI*****
***VPDN*****************************************************************************TGAKRKSREDREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKCTQKQTATRDVPLVFSSI*****************
MDLVPDNYGGYMPPPSNTHNGYYHYNNGGFVMPPGPSPTRPAIPTSVIQAAATSSHDDLYFLELGFQQRVKKK*********************REYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKCTQKQTATRDVPLVFSSIMGHVLTSVIGTITNEAS
*DLVPDNYGGYMPPPSNTHNGYYHYNNGGFVMPPGPSPTRPAIPTSVIQAAATSSHDDLYFLELGFQQ************************EDREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKCTQKQTATRDVPLVFSSIMGHVLTSVIGTITNE**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLVPDNYGGYMPPPSNTHNGYYHYNNGGFVMPPGPSPTRPAIPTSVIQAAATSSHDDLYFLELGFQQRVKKKIRRVKSEGTPGTGAKRKSREDREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKCTQKQTATRDVPLVFSSIMGHVLTSVIGTITNEAS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query189 2.2.26 [Sep-21-2011]
Q7M3M6873 Ecdysone-induced protein N/A N/A 0.497 0.107 0.646 8e-29
P20105829 Ecdysone-induced protein yes N/A 0.497 0.113 0.652 9e-29
P11536883 Ecdysone-induced protein no N/A 0.497 0.106 0.652 9e-29
Q9JHC9 593 ETS-related transcription yes N/A 0.343 0.109 0.609 2e-23
Q15723 593 ETS-related transcription yes N/A 0.343 0.109 0.609 3e-23
P32519 619 ETS-related transcription no N/A 0.269 0.082 0.823 4e-22
A0JN51 614 ETS-related transcription no N/A 0.269 0.083 0.823 5e-22
Q99607 663 ETS-related transcription no N/A 0.269 0.076 0.803 4e-21
Q9Z2U4 655 ETS-related transcription no N/A 0.269 0.077 0.803 6e-21
Q60775 612 ETS-related transcription no N/A 0.269 0.083 0.823 9e-20
>sp|Q7M3M6|E74EF_DROVI Ecdysone-induced protein 74EF OS=Drosophila virilis GN=Eip74EF PE=2 SV=1 Back     alignment and function desciption
 Score =  126 bits (317), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 75/116 (64%), Positives = 80/116 (68%), Gaps = 22/116 (18%)

Query: 46  SVIQAAATSS--HDDLYFLELG-FQQRVKKKIRRVKSEGTPGTGAKRKSRE--------- 93
           SVIQ  ATSS  +D  Y LELG FQQ   KK R+ K E     G KR SRE         
Sbjct: 727 SVIQQPATSSVNYDLSYMLELGGFQQAKAKKPRKPKLE----MGVKRASREGSTTYLWEF 782

Query: 94  ------DREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALR 143
                 DREYCPR+IKWTNRE+GVFKLVDSKAVSRLWG+HKNKPDMNYETMGRALR
Sbjct: 783 LLKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALR 838
Probably acts as a transcription factor during metamorphosis.
Drosophila virilis (taxid: 7244)
>sp|P20105|E74EA_DROME Ecdysone-induced protein 74EF isoform A OS=Drosophila melanogaster GN=Eip74EF PE=2 SV=2 Back     alignment and function description
>sp|P11536|E74EB_DROME Ecdysone-induced protein 74EF isoform B OS=Drosophila melanogaster GN=Eip74EF PE=2 SV=2 Back     alignment and function description
>sp|Q9JHC9|ELF2_MOUSE ETS-related transcription factor Elf-2 OS=Mus musculus GN=Elf2 PE=1 SV=1 Back     alignment and function description
>sp|Q15723|ELF2_HUMAN ETS-related transcription factor Elf-2 OS=Homo sapiens GN=ELF2 PE=1 SV=2 Back     alignment and function description
>sp|P32519|ELF1_HUMAN ETS-related transcription factor Elf-1 OS=Homo sapiens GN=ELF1 PE=1 SV=2 Back     alignment and function description
>sp|A0JN51|ELF1_BOVIN ETS-related transcription factor Elf-1 OS=Bos taurus GN=ELF1 PE=2 SV=1 Back     alignment and function description
>sp|Q99607|ELF4_HUMAN ETS-related transcription factor Elf-4 OS=Homo sapiens GN=ELF4 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z2U4|ELF4_MOUSE ETS-related transcription factor Elf-4 OS=Mus musculus GN=Elf4 PE=2 SV=2 Back     alignment and function description
>sp|Q60775|ELF1_MOUSE ETS-related transcription factor Elf-1 OS=Mus musculus GN=Elf1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
340711441 576 PREDICTED: hypothetical protein LOC10065 0.698 0.229 0.593 5e-37
350416210 576 PREDICTED: hypothetical protein LOC10074 0.698 0.229 0.593 6e-37
58585204 554 ecdysteroid-regulated gene E74 [Apis mel 0.698 0.238 0.593 8e-37
307169177174 Ecdysone-induced protein 74EF isoform B 0.629 0.683 0.637 8e-37
383848570 554 PREDICTED: uncharacterized protein LOC10 0.597 0.203 0.648 9e-37
322800837185 hypothetical protein SINV_02897 [Solenop 0.677 0.691 0.601 9e-36
156544181 565 PREDICTED: hypothetical protein LOC10012 0.587 0.196 0.589 2e-34
189234090 565 PREDICTED: similar to E74 [Tribolium cas 0.529 0.176 0.663 9e-31
270002515199 hypothetical protein TcasGA2_TC004816 [T 0.529 0.502 0.655 1e-30
427780525 557 Putative dna-dependent evidence-iss [Rhi 0.566 0.192 0.551 1e-28
>gi|340711441|ref|XP_003394284.1| PREDICTED: hypothetical protein LOC100651988 [Bombus terrestris] Back     alignment and taxonomy information
 Score =  159 bits (402), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 101/155 (65%), Gaps = 23/155 (14%)

Query: 11  YMPPP--SNTHNGYYH--YNNGG-FVMPPGPSPTRP--AIPTSVIQAAATSSHDDLYFLE 63
           Y  PP  S +++ Y +  Y +G  F  P  PSP R    +PTSVIQAA +S  DDLY LE
Sbjct: 388 YRQPPTLSESYSSYVNSMYASGAQFATPCTPSPPRGPGGVPTSVIQAATSSVSDDLYLLE 447

Query: 64  LGFQQRVKKKIRRVKSEGTPGTGAKRKSRE---------------DREYCPRYIKWTNRE 108
           LGF  R KK   +   +G  G   KRKSRE               DREYCPRYIKWTNRE
Sbjct: 448 LGFPPRSKKNKLKKPRQGD-GAAVKRKSREGSTTYLWEFLLKLLQDREYCPRYIKWTNRE 506

Query: 109 RGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALR 143
           RGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALR
Sbjct: 507 RGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALR 541

Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350416210|ref|XP_003490875.1| PREDICTED: hypothetical protein LOC100748014 [Bombus impatiens] Back     alignment and taxonomy information
>gi|58585204|ref|NP_001011631.1| ecdysteroid-regulated gene E74 [Apis mellifera] gi|52313430|dbj|BAD51404.1| E74 [Apis mellifera] Back     alignment and taxonomy information
>gi|307169177|gb|EFN61993.1| Ecdysone-induced protein 74EF isoform B [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383848570|ref|XP_003699922.1| PREDICTED: uncharacterized protein LOC100874650 [Megachile rotundata] Back     alignment and taxonomy information
>gi|322800837|gb|EFZ21707.1| hypothetical protein SINV_02897 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|156544181|ref|XP_001606426.1| PREDICTED: hypothetical protein LOC100122824 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|189234090|ref|XP_966617.2| PREDICTED: similar to E74 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270002515|gb|EEZ98962.1| hypothetical protein TcasGA2_TC004816 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|427780525|gb|JAA55714.1| Putative dna-dependent evidence-iss [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query189
FB|FBgn0000567883 Eip74EF "Ecdysone-induced prot 0.497 0.106 0.608 7.5e-25
UNIPROTKB|G3V7H5 531 Elf2 "Protein Elf2" [Rattus no 0.269 0.096 0.823 2.7e-22
UNIPROTKB|F1M3B5 570 Elf2 "Protein Elf2" [Rattus no 0.269 0.089 0.823 3.9e-22
RGD|1310585 591 Elf2 "E74-like factor 2" [Ratt 0.269 0.086 0.823 4.6e-22
UNIPROTKB|E1C717 595 ELF2 "Uncharacterized protein" 0.269 0.085 0.823 4.7e-22
UNIPROTKB|F1N599 582 ELF2 "Uncharacterized protein" 0.269 0.087 0.823 5.4e-22
MGI|MGI:1916507 593 Elf2 "E74-like factor 2" [Mus 0.269 0.086 0.823 5.9e-22
UNIPROTKB|E2QU99 592 ELF2 "Uncharacterized protein" 0.269 0.086 0.823 7.5e-22
UNIPROTKB|Q15723 593 ELF2 "ETS-related transcriptio 0.269 0.086 0.823 7.5e-22
ZFIN|ZDB-GENE-031215-1 607 elf2b "E74-like factor 2b (ets 0.343 0.107 0.629 1.6e-21
FB|FBgn0000567 Eip74EF "Ecdysone-induced protein 74EF" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 294 (108.6 bits), Expect = 7.5e-25, P = 7.5e-25
 Identities = 70/115 (60%), Positives = 76/115 (66%)

Query:    46 SVIQAAATS-SHDDLYFLELG-FQQXXXXXXXXXXSEGTPGTGAKRKSRE---------- 93
             SVIQ A +S S+D  Y LELG FQQ           E     G KR+SRE          
Sbjct:   738 SVIQPATSSVSYDLSYMLELGGFQQRKAKKPRKPKLE----MGVKRRSREGSTTYLWEFL 793

Query:    94 -----DREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALR 143
                  DREYCPR+IKWTNRE+GVFKLVDSKAVSRLWG+HKNKPDMNYETMGRALR
Sbjct:   794 LKLLQDREYCPRFIKWTNREKGVFKLVDSKAVSRLWGMHKNKPDMNYETMGRALR 848
GO:0005634 "nucleus" evidence=ISS;NAS;IDA
GO:0001077 "RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription" evidence=IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS;NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;TAS
GO:0035071 "salivary gland cell autophagic cell death" evidence=IMP;NAS
GO:0048477 "oogenesis" evidence=NAS
GO:0006914 "autophagy" evidence=IMP
GO:0008219 "cell death" evidence=TAS
GO:0040034 "regulation of development, heterochronic" evidence=TAS
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0009987 "cellular process" evidence=IMP
UNIPROTKB|G3V7H5 Elf2 "Protein Elf2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M3B5 Elf2 "Protein Elf2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1310585 Elf2 "E74-like factor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C717 ELF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N599 ELF2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1916507 Elf2 "E74-like factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QU99 ELF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15723 ELF2 "ETS-related transcription factor Elf-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031215-1 elf2b "E74-like factor 2b (ets domain transcription factor)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P20105E74EA_DROMENo assigned EC number0.65210.49730.1133yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
pfam0017885 pfam00178, Ets, Ets-domain 3e-23
smart0041387 smart00413, ETS, erythroblast transformation speci 1e-22
>gnl|CDD|143944 pfam00178, Ets, Ets-domain Back     alignment and domain information 
 Score = 88.1 bits (219), Expect = 3e-23
 Identities = 26/50 (52%), Positives = 37/50 (74%)

Query: 94  DREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALR 143
             +    +I+WT R++G FKLVD + V+RLWG+ KNKP+MNY+ + RALR
Sbjct: 13  TDQDNRDFIRWTGRDKGEFKLVDPEEVARLWGIRKNKPNMNYDKLSRALR 62

Length = 85
>gnl|CDD|197710 smart00413, ETS, erythroblast transformation specific domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 189
smart0041387 ETS erythroblast transformation specific domain. v 100.0
KOG3806|consensus177 100.0
PF0017885 Ets: Ets-domain; InterPro: IPR000418 Transcription 100.0
KOG3805|consensus361 99.97
KOG3804|consensus390 99.96
KOG3804|consensus 390 99.1
smart00415105 HSF heat shock factor. 94.64
PF00447103 HSF_DNA-bind: HSF-type DNA-binding; InterPro: IPR0 94.55
COG5169 282 HSF1 Heat shock transcription factor [Transcriptio 88.0
>smart00413 ETS erythroblast transformation specific domain Back     alignment and domain information 
Probab=100.00  E-value=1.1e-39  Score=245.53  Aligned_cols=84  Identities=37%  Similarity=0.463  Sum_probs=80.9

Q ss_pred             CCchHHhHHhhhCcCCCCCCeEEeeCCCeeEEEeChHHHHHHHhccCCCCCCcHHHHHHHHHHHhhcCeeEecccCceeE
Q psy6350          82 TPGTGAKRKSREDREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKCTQKQTA  161 (189)
Q Consensus        82 ~~l~~Flr~lLed~e~~~~~I~Wtdk~~geFk~vdpe~VArLWG~rKnkp~MtYeKmSRaLRyYY~kgIL~Kv~GqrltY  161 (189)
                      .+||+||++||+|++ ++++|+|+|+++|+|||+||++||+|||.+|||++||||||||||||||++|||+||.|++++|
T Consensus         2 ~~Lw~FL~~LL~d~~-~~~~I~W~~k~~g~Fkl~~~~~vA~lWG~~Knk~~M~YeklSRaLRyyy~~~il~Kv~g~rl~Y   80 (87)
T smart00413        2 IQLWQFLLDLLLDPE-NGDIIRWTDRDGGEFKLVDPEEVARLWGQRKNKPNMNYEKLSRALRYYYKKNILRKVPGKRLVY   80 (87)
T ss_pred             ccHHHHHHHHHcCcc-CCCeEEeeCCCCCEEEecCHHHHHHHHhhhcCCCCCCHHHHHHHHHHHHhcCcEEecCCceEEE
Confidence            579999999999985 7999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCc
Q psy6350         162 TRDVP  166 (189)
Q Consensus       162 ~f~~~  166 (189)
                      +|..+
T Consensus        81 ~F~~~   85 (87)
T smart00413       81 KFVKN   85 (87)
T ss_pred             ecCCC
Confidence            99764

variation of the helix-turn-helix motif
>KOG3806|consensus Back     alignment and domain information
>PF00178 Ets: Ets-domain; InterPro: IPR000418 Transcription factors are protein molecules that bind to specific DNA sequences in the genome, resulting in the induction or inhibition of gene transcription [] Back     alignment and domain information
>KOG3805|consensus Back     alignment and domain information
>KOG3804|consensus Back     alignment and domain information
>KOG3804|consensus Back     alignment and domain information
>smart00415 HSF heat shock factor Back     alignment and domain information
>PF00447 HSF_DNA-bind: HSF-type DNA-binding; InterPro: IPR000232 Heat shock factor (HSF) is a transcriptional activator of heat shock genes []: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs [] Back     alignment and domain information
>COG5169 HSF1 Heat shock transcription factor [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1yo5_C97 Analysis Of The 2.0a Crystal Structure Of The Prote 6e-11
1dux_C94 Elk-1DNA STRUCTURE REVEALS HOW RESIDUES DISTAL FROM 4e-10
2lf8_A128 Intramolecular Regulation Of The Ets Domain Within 2e-09
2dao_A118 Solution Structure Of Ets Domain Transcriptional Fa 2e-09
2lf7_A106 Intramolecular Regulation Of The Ets Domain Within 4e-09
1hbx_G157 Ternary Complex Of Sap-1 And Srf With Specific Sre 3e-08
1bc7_C93 Serum Response Factor Accessory Protein 1a (Sap-1)D 6e-08
3jtg_A103 Crystal Structure Of Mouse Elf3 C-Terminal Dna-Bind 4e-07
1wwx_A107 Solution Structure Of The Ets-Domain Of The Ets Dom 2e-06
3mfk_A162 Ets1 Complex With Stromelysin-1 Promoter Dna Length 3e-06
3ri4_A163 Ets1 Cooperative Binding To Widely Separated Sites 3e-06
1mdm_B161 Inhibited Fragment Of Ets-1 And Paired Domain Of Pa 3e-06
1r36_A140 Nmr-Based Structure Of Autoinhibited Murine Ets-1 D 4e-06
1md0_A141 Crystal Structure Of An Inhibited Fragment Of Ets-1 4e-06
1gvj_A146 Ets-1 Dna Binding And Autoinhibitory Domains Length 4e-06
2stt_A96 Solution Nmr Structure Of The Human Ets1DNA COMPLEX 5e-06
1k78_B110 Pax5(1-149)+ets-1(331-440)+dna Length = 110 5e-06
4avp_A106 Crystal Structure Of The Dna-Binding Domain Of Huma 6e-06
2nny_A171 Crystal Structure Of The Ets1 Dimer Dna Complex. Le 3e-05
2ypr_A102 Crystal Structure Of The Dna Binding Ets Domain Of 7e-05
1awc_A110 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 8e-05
1fli_A98 Dna-Binding Domain Of Fli-1 Length = 98 1e-04
>pdb|1YO5|C Chain C, Analysis Of The 2.0a Crystal Structure Of The Protein-Dna Complex Of Human Pdef Ets Domain Bound To The Prostate Specific Antigen Regulatory Site Length = 97 Back     alignment and structure 
Iteration: 1

 Score = 63.5 bits (153), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 36/45 (80%)
Query: 100 RYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRS 144
           R+I+W N+E+G+FK+ DS  V+RLWG+ KN+P MNY+ + R++R 
Sbjct: 29  RFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQ 73
>pdb|1DUX|C Chain C, Elk-1DNA STRUCTURE REVEALS HOW RESIDUES DISTAL FROM DNA- Binding Surface Affect Dna-Recognition Length = 94 Back     alignment and structure
>pdb|2LF8|A Chain A, Intramolecular Regulation Of The Ets Domain Within Etv6 Sequence R335 To R458 Length = 128 Back     alignment and structure
>pdb|2DAO|A Chain A, Solution Structure Of Ets Domain Transcriptional Factor Etv6 Protein Length = 118 Back     alignment and structure
>pdb|2LF7|A Chain A, Intramolecular Regulation Of The Ets Domain Within Etv6 Sequence R335 To Q436 Length = 106 Back     alignment and structure
>pdb|1HBX|G Chain G, Ternary Complex Of Sap-1 And Srf With Specific Sre Dna Length = 157 Back     alignment and structure
>pdb|1BC7|C Chain C, Serum Response Factor Accessory Protein 1a (Sap-1)DNA Complex Length = 93 Back     alignment and structure
>pdb|3JTG|A Chain A, Crystal Structure Of Mouse Elf3 C-Terminal Dna-Binding Domai Complex With Type Ii Tgf-Beta Receptor Promoter Dna Length = 103 Back     alignment and structure
>pdb|1WWX|A Chain A, Solution Structure Of The Ets-Domain Of The Ets Domain Transcription Factor Length = 107 Back     alignment and structure
>pdb|3MFK|A Chain A, Ets1 Complex With Stromelysin-1 Promoter Dna Length = 162 Back     alignment and structure
>pdb|3RI4|A Chain A, Ets1 Cooperative Binding To Widely Separated Sites On Promoter Dna Length = 163 Back     alignment and structure
>pdb|1MDM|B Chain B, Inhibited Fragment Of Ets-1 And Paired Domain Of Pax5 Bound To Dna Length = 161 Back     alignment and structure
>pdb|1R36|A Chain A, Nmr-Based Structure Of Autoinhibited Murine Ets-1 Deltan301 Length = 140 Back     alignment and structure
>pdb|1MD0|A Chain A, Crystal Structure Of An Inhibited Fragment Of Ets-1 Length = 141 Back     alignment and structure
>pdb|1GVJ|A Chain A, Ets-1 Dna Binding And Autoinhibitory Domains Length = 146 Back     alignment and structure
>pdb|2STT|A Chain A, Solution Nmr Structure Of The Human Ets1DNA COMPLEX, 25 Structures Length = 96 Back     alignment and structure
>pdb|1K78|B Chain B, Pax5(1-149)+ets-1(331-440)+dna Length = 110 Back     alignment and structure
>pdb|4AVP|A Chain A, Crystal Structure Of The Dna-Binding Domain Of Human Etv1. Length = 106 Back     alignment and structure
>pdb|2NNY|A Chain A, Crystal Structure Of The Ets1 Dimer Dna Complex. Length = 171 Back     alignment and structure
>pdb|2YPR|A Chain A, Crystal Structure Of The Dna Binding Ets Domain Of Human Protein Fev Length = 102 Back     alignment and structure
>pdb|1AWC|A Chain A, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 110 Back     alignment and structure
>pdb|1FLI|A Chain A, Dna-Binding Domain Of Fli-1 Length = 98 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query189
1yo5_C97 SAM pointed domain containing ETS transcription fa 7e-18
1wwx_A107 E74-like factor 5 ESE-2B; DNA binding, transcripti 2e-17
3jtg_A103 ETS-related transcription factor ELF-3; ELF3, prot 3e-17
2dao_A118 Transcription factor ETV6; ETS domain, structural 1e-15
2lf8_A128 Transcription factor ETV6; auto-inhibition; NMR {M 9e-15
1bc8_C93 SAP-1, protein (SAP-1 ETS domain); DNA-binding dom 7e-13
1fli_A98 FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: 2e-12
1awc_A110 Protein (GA binding protein alpha); complex (trans 2e-12
1pue_E89 Protein (transcription factor PU.1 (TF PU.1)); com 2e-11
1hbx_G157 ETS-domain protein ELK-4; gene regulation, transcr 4e-11
4avp_A106 ETS translocation variant 1; transcription, transc 6e-11
2nny_A171 C-ETS-1 protein, P54; protein-DNA complex, transcr 1e-10
1gvj_A146 C-ETS-1 protein, P54; transcription, autoinhibitio 3e-10
>1yo5_C SAM pointed domain containing ETS transcription factor; protein-DNA complex, double helix, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.4.5.21 Length = 97 Back     alignment and structure
 Score = 73.9 bits (181), Expect = 7e-18
 Identities = 23/51 (45%), Positives = 36/51 (70%)

Query: 94  DREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRS 144
                 R+I+W N+E+G+FK+ DS  V+RLWG+ KN+P MNY+ + R++R 
Sbjct: 23  KPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQ 73
>1wwx_A E74-like factor 5 ESE-2B; DNA binding, transcriptional activation and repression, structural genomics; NMR {Homo sapiens} SCOP: a.4.5.21 Length = 107 Back     alignment and structure
>3jtg_A ETS-related transcription factor ELF-3; ELF3, protein-DNA complex, type II TGF-beta receptor, activa alternative splicing, cytoplasm; HET: DNA; 2.20A {Mus musculus} Length = 103 Back     alignment and structure
>2dao_A Transcription factor ETV6; ETS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2lf8_A Transcription factor ETV6; auto-inhibition; NMR {Mus musculus} Length = 128 Back     alignment and structure
>1bc8_C SAP-1, protein (SAP-1 ETS domain); DNA-binding domain, winged helix-turn-helix, DNA-binding specificity, transcription/DNA complex; HET: DNA; 1.93A {Homo sapiens} SCOP: a.4.5.21 PDB: 1bc7_C* 1k6o_A 1dux_C* Length = 93 Back     alignment and structure
>1fli_A FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: a.4.5.21 Length = 98 Back     alignment and structure
>1awc_A Protein (GA binding protein alpha); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: a.4.5.21 Length = 110 Back     alignment and structure
>1pue_E Protein (transcription factor PU.1 (TF PU.1)); complex (transcription regulating/DNA), oncogene, transforming protein, DNA- binding, activator; HET: DNA; 2.10A {Mus musculus} SCOP: a.4.5.21 Length = 89 Back     alignment and structure
>1hbx_G ETS-domain protein ELK-4; gene regulation, transcription complex; 3.15A {Homo sapiens} SCOP: a.4.5.21 Length = 157 Back     alignment and structure
>4avp_A ETS translocation variant 1; transcription, transcriptional activation and repression, DN binding protein, E twenty-SIX, erwing sarcoma; 1.82A {Homo sapiens} Length = 106 Back     alignment and structure
>2nny_A C-ETS-1 protein, P54; protein-DNA complex, transcription/DNA complex; 2.58A {Homo sapiens} PDB: 3ri4_A 3mfk_A 1mdm_B Length = 171 Back     alignment and structure
>1gvj_A C-ETS-1 protein, P54; transcription, autoinhibition, ETS domain; 1.53A {Homo sapiens} SCOP: a.4.5.21 PDB: 1md0_A 1r36_A 1k78_B 1k79_A* 1k7a_A* 2stt_A* 2stw_A* Length = 146 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
1yo5_C97 SAM pointed domain containing ETS transcription fa 100.0
3jtg_A103 ETS-related transcription factor ELF-3; ELF3, prot 100.0
1wwx_A107 E74-like factor 5 ESE-2B; DNA binding, transcripti 100.0
1fli_A98 FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: 100.0
1bc8_C93 SAP-1, protein (SAP-1 ETS domain); DNA-binding dom 100.0
1awc_A110 Protein (GA binding protein alpha); complex (trans 100.0
2ypr_A102 Protein FEV; transcription; 2.64A {Homo sapiens} P 100.0
2dao_A118 Transcription factor ETV6; ETS domain, structural 100.0
1pue_E89 Protein (transcription factor PU.1 (TF PU.1)); com 100.0
1gvj_A146 C-ETS-1 protein, P54; transcription, autoinhibitio 100.0
4avp_A106 ETS translocation variant 1; transcription, transc 100.0
2nny_A171 C-ETS-1 protein, P54; protein-DNA complex, transcr 100.0
2lf8_A128 Transcription factor ETV6; auto-inhibition; NMR {M 100.0
1hbx_G157 ETS-domain protein ELK-4; gene regulation, transcr 100.0
2ldu_A125 Heat shock factor protein 1; structural genomics, 93.74
3hts_B102 Heat shock transcription factor; transcription reg 93.25
1hks_A106 Heat-shock transcription factor; transcription reg 91.84
>1yo5_C SAM pointed domain containing ETS transcription factor; protein-DNA complex, double helix, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
Probab=100.00  E-value=9.6e-41  Score=254.13  Aligned_cols=89  Identities=30%  Similarity=0.518  Sum_probs=84.0

Q ss_pred             CCCCCchHHhHHhhhCcCCCCCCeEEeeCCCeeEEEeChHHHHHHHhccCCCCCCcHHHHHHHHHHHhhcCeeEecc-cC
Q psy6350          79 SEGTPGTGAKRKSREDREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKC-TQ  157 (189)
Q Consensus        79 ~~g~~l~~Flr~lLed~e~~~~~I~Wtdk~~geFk~vdpe~VArLWG~rKnkp~MtYeKmSRaLRyYY~kgIL~Kv~-Gq  157 (189)
                      .+..+||+||++||+|+++|++||+|+|+++|+|||+||++||+|||.+|||++||||||||||||||++|||+||. |+
T Consensus         8 ~~~i~LwqFL~eLL~d~~~~~~~I~W~~~~~g~Fkl~d~~~VArlWG~rKnkp~MnYeklSRaLRyYY~~~ii~Kv~~g~   87 (97)
T 1yo5_C            8 SQPIHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQ   87 (97)
T ss_dssp             -CCCCHHHHHHHHHHCHHHHTTTEEEEETTTTEEEESCHHHHHHHHHHHHTCTTCCHHHHHHHHHHTTTTTSEECCSSCC
T ss_pred             CCeeEHHHHHHHHhcCcccCCCceEeecCCCCEEEecCHHHHHHHHHhcCCCCCcCHHHHHHHHHHHHhcCcEeeccCCc
Confidence            34589999999999998888999999999999999999999999999999999999999999999999999999997 89


Q ss_pred             ceeEEecCcc
Q psy6350         158 KQTATRDVPL  167 (189)
Q Consensus       158 rltY~f~~~~  167 (189)
                      |++|+|..||
T Consensus        88 r~vY~F~~~~   97 (97)
T 1yo5_C           88 RLVYQFVHPI   97 (97)
T ss_dssp             TTEEEESCC-
T ss_pred             EEEEecCCCC
Confidence            9999999885
>3jtg_A ETS-related transcription factor ELF-3; ELF3, protein-DNA complex, type II TGF-beta receptor, activa alternative splicing, cytoplasm; HET: DNA; 2.20A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>1wwx_A E74-like factor 5 ESE-2B; DNA binding, transcriptional activation and repression, structural genomics; NMR {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>1fli_A FLI-1; transcription/DNA; NMR {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>1bc8_C SAP-1, protein (SAP-1 ETS domain); DNA-binding domain, winged helix-turn-helix, DNA-binding specificity, transcription/DNA complex; HET: DNA; 1.93A {Homo sapiens} SCOP: a.4.5.21 PDB: 1bc7_C* 1k6o_A 1dux_C* Back     alignment and structure
>1awc_A Protein (GA binding protein alpha); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>2ypr_A Protein FEV; transcription; 2.64A {Homo sapiens} PDB: 1fli_A Back     alignment and structure
>2dao_A Transcription factor ETV6; ETS domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1pue_E Protein (transcription factor PU.1 (TF PU.1)); complex (transcription regulating/DNA), oncogene, transforming protein, DNA- binding, activator; HET: DNA; 2.10A {Mus musculus} SCOP: a.4.5.21 Back     alignment and structure
>1gvj_A C-ETS-1 protein, P54; transcription, autoinhibition, ETS domain; 1.53A {Homo sapiens} SCOP: a.4.5.21 PDB: 1md0_A 1r36_A 1k78_B 1k79_A* 1k7a_A* 2stt_A* 2stw_A* Back     alignment and structure
>4avp_A ETS translocation variant 1; transcription, transcriptional activation and repression, DN binding protein, E twenty-SIX, erwing sarcoma; 1.82A {Homo sapiens} PDB: 4b06_A Back     alignment and structure
>2nny_A C-ETS-1 protein, P54; protein-DNA complex, transcription/DNA complex; 2.58A {Homo sapiens} PDB: 3ri4_A 3mfk_A 1mdm_B Back     alignment and structure
>2lf8_A Transcription factor ETV6; auto-inhibition; NMR {Mus musculus} Back     alignment and structure
>1hbx_G ETS-domain protein ELK-4; gene regulation, transcription complex; 3.15A {Homo sapiens} SCOP: a.4.5.21 Back     alignment and structure
>2ldu_A Heat shock factor protein 1; structural genomics, northeast structural genomics consortiu DNA-binding, PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3hts_B Heat shock transcription factor; transcription regulation, DNA-binding protein, complex (WING helix_TURN_ helix-DNA); 1.75A {Kluyveromyces lactis} SCOP: a.4.5.22 PDB: 2hts_A 1fyk_A* 1fym_A 1fyl_A 3hsf_A 1fbu_A 1fbs_A 1fbq_A Back     alignment and structure
>1hks_A Heat-shock transcription factor; transcription regulation; NMR {Drosophila melanogaster} SCOP: a.4.5.22 PDB: 1hkt_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 189
d1wwxa194 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human 1e-21
d1yo5c188 a.4.5.21 (C:247-334) Sam pointed domain containing 3e-21
d1duxc_86 a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 1e-20
d1awca_110 a.4.5.21 (A:) GA binding protein (GABP) alpha {Mou 2e-17
d1puee_88 a.4.5.21 (E:) Transcription factor PU.1, residues 4e-17
d1hbxg_155 a.4.5.21 (G:) Serum response factor accessory prot 9e-17
d1flia_98 a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 9e-17
d1gvja_142 a.4.5.21 (A:) ETS-1 transcription factor, residues 4e-16
>d1wwxa1 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: ets domain
domain: E74-like factor 5 ese-2b
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 82.2 bits (203), Expect = 1e-21
 Identities = 19/50 (38%), Positives = 32/50 (64%)

Query: 94  DREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALR 143
             E     ++W +RE+G+F++V S+A++++WG  K    M YE + RALR
Sbjct: 14  SPEENCGILEWEDREQGIFRVVKSEALAKMWGQRKKNDRMTYEKLSRALR 63
>d1yo5c1 a.4.5.21 (C:247-334) Sam pointed domain containing ets transcription SPDEF {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1duxc_ a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1awca_ a.4.5.21 (A:) GA binding protein (GABP) alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 110 Back     information, alignment and structure
>d1puee_ a.4.5.21 (E:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1gvja_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query189
d1yo5c188 Sam pointed domain containing ets transcription SP 100.0
d1duxc_86 Elk-1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wwxa194 E74-like factor 5 ese-2b {Human (Homo sapiens) [Ta 100.0
d1awca_110 GA binding protein (GABP) alpha {Mouse (Mus muscul 100.0
d1flia_98 Fli-1 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1gvja_142 ETS-1 transcription factor, residues 331-440 {Huma 100.0
d1puee_88 Transcription factor PU.1, residues 171-259 {Mouse 100.0
d1hbxg_155 Serum response factor accessory protein 1a, SAP-1 100.0
d2htsa_92 Heat-shock transcription factor {Milk yeast (Kluyv 95.24
d1hksa_106 Heat-shock transcription factor {Drosophila melano 94.64
d2irfg_109 Interferon regulatory factor-2, IRF-2 {Mouse (Mus 80.05
>d1yo5c1 a.4.5.21 (C:247-334) Sam pointed domain containing ets transcription SPDEF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: ets domain
domain: Sam pointed domain containing ets transcription SPDEF
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.8e-41  Score=251.57  Aligned_cols=85  Identities=31%  Similarity=0.522  Sum_probs=82.5

Q ss_pred             CCchHHhHHhhhCcCCCCCCeEEeeCCCeeEEEeChHHHHHHHhccCCCCCCcHHHHHHHHHHHhhcCeeEecc-cCcee
Q psy6350          82 TPGTGAKRKSREDREYCPRYIKWTNRERGVFKLVDSKAVSRLWGLHKNKPDMNYETMGRALRSSVVLTRLRTKC-TQKQT  160 (189)
Q Consensus        82 ~~l~~Flr~lLed~e~~~~~I~Wtdk~~geFk~vdpe~VArLWG~rKnkp~MtYeKmSRaLRyYY~kgIL~Kv~-Gqrlt  160 (189)
                      .+||+||++||+|+++|+++|+|||+++|+|||+||++||+|||.+|||++||||||||||||||++|||+||. |+|++
T Consensus         3 i~Lw~FL~~LL~d~~~~~~~I~Wt~~~~g~Fkl~~~~~VA~lWG~~Knk~~M~YeklSRALRyYY~~~il~Kv~~g~rl~   82 (88)
T d1yo5c1           3 IHLWQFLKELLLKPHSYGRFIRWLNKEKGIFKIEDSAQVARLWGIRKNRPAMNYDKLSRSIRQYYKKGIIRKPDISQRLV   82 (88)
T ss_dssp             CCHHHHHHHHHHCHHHHTTTEEEEETTTTEEEESCHHHHHHHHHHHHTCTTCCHHHHHHHHHHTTTTTSEECCSSCCTTE
T ss_pred             chHHHHHHHHHcCccccCCCeEEECCCCceEEecCHHHHHHHHHHhhcCCCCCHHHHHHHHHHHHhccceeeccCCcEeE
Confidence            68999999999998889999999999999999999999999999999999999999999999999999999997 99999


Q ss_pred             EEecCc
Q psy6350         161 ATRDVP  166 (189)
Q Consensus       161 Y~f~~~  166 (189)
                      |+|..|
T Consensus        83 Y~Fv~p   88 (88)
T d1yo5c1          83 YQFVHP   88 (88)
T ss_dssp             EEESCC
T ss_pred             EeCCCC
Confidence            999876
>d1duxc_ a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwxa1 a.4.5.21 (A:8-101) E74-like factor 5 ese-2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awca_ a.4.5.21 (A:) GA binding protein (GABP) alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1flia_ a.4.5.21 (A:) Fli-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvja_ a.4.5.21 (A:) ETS-1 transcription factor, residues 331-440 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1puee_ a.4.5.21 (E:) Transcription factor PU.1, residues 171-259 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hbxg_ a.4.5.21 (G:) Serum response factor accessory protein 1a, SAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2htsa_ a.4.5.22 (A:) Heat-shock transcription factor {Milk yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1hksa_ a.4.5.22 (A:) Heat-shock transcription factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2irfg_ a.4.5.23 (G:) Interferon regulatory factor-2, IRF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure