Diaphorina citri psyllid: psy6369


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MDGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSLLLI
ccccEEEEEEccccccccccccEEEEEECcccccccHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccHHHHHHHHHHHHHccccccc
MDGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSLLLI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSLLLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein phosphatase Slingshot Protein phosphatase which regulates actin filament dynamics. Dephosphorylates and activates the actin binding/depolymerizing factor tsr/cofilin, which subsequently binds to actin filaments and stimulates their disassembly.confidentQ6NN85
Protein phosphatase Slingshot homolog 2 Protein phosphatase which regulates actin filament dynamics. Dephosphorylates and activates the actin binding/depolymerizing factor cofilin, which subsequently binds to actin filaments and stimulates their disassembly. Inhibitory phosphorylation of cofilin is mediated by LIMK1, which may also be dephosphorylated and inactivated by this protein.confidentQ5SW75
Protein phosphatase Slingshot homolog 2 Protein phosphatase which regulates actin filament dynamics. Dephosphorylates and activates the actin binding/depolymerizing factor cofilin, which subsequently binds to actin filaments and stimulates their disassembly. Inhibitory phosphorylation of cofilin is mediated by LIMK1, which may also be dephosphorylated and inactivated by this protein.confidentQ76I76

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008064 [BP]regulation of actin polymerization or depolymerizationprobableGO:0030832, GO:0065008, GO:0033043, GO:0071840, GO:0032970, GO:0051493, GO:0016043, GO:0090066, GO:0051128, GO:0065007, GO:0044763, GO:0044699, GO:0032956, GO:0008150, GO:0009987, GO:0050794, GO:0050789, GO:0032535
GO:0050770 [BP]regulation of axonogenesisprobableGO:0022604, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0008330 [MF]protein tyrosine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0004725 [MF]protein tyrosine phosphatase activityprobableGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0030036 [BP]actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0043067 [BP]regulation of programmed cell deathprobableGO:0008150, GO:0010941, GO:0065007, GO:0050789, GO:0050794
GO:0000278 [BP]mitotic cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0010591 [BP]regulation of lamellipodium assemblyprobableGO:0051128, GO:0044087, GO:0060491, GO:0065007, GO:0008150, GO:0050794, GO:0031344, GO:0050789
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0017017 [MF]MAP kinase tyrosine/serine/threonine phosphatase activityprobableGO:0016787, GO:0016791, GO:0008138, GO:0004721, GO:0042578, GO:0003824, GO:0003674, GO:0016788, GO:0033549
GO:0043407 [BP]negative regulation of MAP kinase activityprobableGO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0044092, GO:0048585, GO:0031324, GO:0048583, GO:0023057, GO:0043405, GO:0010648, GO:0023051, GO:0009892, GO:0071901, GO:0071900, GO:0010627, GO:0043086, GO:0043409, GO:0043408, GO:0051248, GO:0010646, GO:0010605, GO:0009968, GO:0009966, GO:0051348, GO:0051246, GO:0050789, GO:0065007, GO:0031399, GO:0048519, GO:0065009, GO:0010741, GO:0006469, GO:0045936, GO:0060255, GO:0031323, GO:0045859, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0042325, GO:0032269, GO:0042326, GO:0050790, GO:0010563, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0035335 [BP]peptidyl-tyrosine dephosphorylationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0006470, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005516 [MF]calmodulin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0080135 [BP]regulation of cellular response to stressprobableGO:0080134, GO:0048583, GO:0050794, GO:0008150, GO:0065007, GO:0050789
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0071318 [BP]cellular response to ATPprobableGO:0070887, GO:0014074, GO:0044699, GO:0009719, GO:0051716, GO:1901698, GO:0071417, GO:0071310, GO:0014070, GO:0046683, GO:0071495, GO:0009987, GO:0044763, GO:0042221, GO:0010033, GO:1901700, GO:1901701, GO:0071407, GO:0010243, GO:1901699, GO:0008150, GO:0033198, GO:0050896
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0016319 [BP]mushroom body developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0048749 [BP]compound eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NT2, chain A
Confidence level:very confident
Coverage over the Query: 2-118
View the alignment between query and template
View the model in PyMOL