Psyllid ID: psy6369


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
MDGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSLLLI
ccccEEEEEEccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccc
cccEEEEEEEcccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccc
MDGVCHILNVTReidnffpgifdycnirvydddktdLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQkrncikpnanfITQLETyqvgvqpsllli
MDGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITqletyqvgvqpsllli
MDGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSLLLI
***VCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQP*****
MDGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSLLLI
MDGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSLLLI
*DGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSL***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSLLLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query123 2.2.26 [Sep-21-2011]
Q6NN85 1045 Protein phosphatase Sling yes N/A 0.902 0.106 0.729 9e-49
Q5SW75 1423 Protein phosphatase Sling yes N/A 0.902 0.078 0.657 8e-42
Q76I76 1423 Protein phosphatase Sling yes N/A 0.902 0.078 0.657 8e-42
Q6IVY4 691 Protein phosphatase Sling N/A N/A 0.894 0.159 0.618 1e-39
Q76I79 1042 Protein phosphatase Sling no N/A 0.902 0.106 0.621 5e-38
Q8WYL5 1049 Protein phosphatase Sling no N/A 0.902 0.105 0.621 5e-38
Q8K330 649 Protein phosphatase Sling no N/A 0.894 0.169 0.563 7e-36
Q5XIS1 652 Protein phosphatase Sling no N/A 0.894 0.168 0.554 3e-35
Q8TE77 659 Protein phosphatase Sling no N/A 0.894 0.166 0.518 1e-31
Q556Y8 476 Probable rhodanese domain yes N/A 0.894 0.231 0.381 3e-20
>sp|Q6NN85|SSH_DROME Protein phosphatase Slingshot OS=Drosophila melanogaster GN=ssh PE=1 SV=2 Back     alignment and function desciption
 Score =  191 bits (486), Expect = 9e-49,   Method: Composition-based stats.
 Identities = 81/111 (72%), Positives = 100/111 (90%)

Query: 2   DGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVH 61
           +GV HILNVTREIDNFFPG F+Y N+RVYDD+KT+LLK+WD+T++YIT AK +GSKVLVH
Sbjct: 408 NGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVH 467

Query: 62  CKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETY 112
           CKMG+SRSASVVIAYAMKAY W+  +A+ HV+++R+CIKPN NF+ QLETY
Sbjct: 468 CKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETY 518




Protein phosphatase which regulates actin filament dynamics. Dephosphorylates and activates the actin binding/depolymerizing factor tsr/cofilin, which subsequently binds to actin filaments and stimulates their disassembly.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q5SW75|SSH2_MOUSE Protein phosphatase Slingshot homolog 2 OS=Mus musculus GN=Ssh2 PE=1 SV=2 Back     alignment and function description
>sp|Q76I76|SSH2_HUMAN Protein phosphatase Slingshot homolog 2 OS=Homo sapiens GN=SSH2 PE=1 SV=1 Back     alignment and function description
>sp|Q6IVY4|SSH_XENLA Protein phosphatase Slingshot homolog OS=Xenopus laevis GN=ssh PE=1 SV=2 Back     alignment and function description
>sp|Q76I79|SSH1_MOUSE Protein phosphatase Slingshot homolog 1 OS=Mus musculus GN=Ssh1 PE=1 SV=1 Back     alignment and function description
>sp|Q8WYL5|SSH1_HUMAN Protein phosphatase Slingshot homolog 1 OS=Homo sapiens GN=SSH1 PE=1 SV=2 Back     alignment and function description
>sp|Q8K330|SSH3_MOUSE Protein phosphatase Slingshot homolog 3 OS=Mus musculus GN=Ssh3 PE=1 SV=1 Back     alignment and function description
>sp|Q5XIS1|SSH3_RAT Protein phosphatase Slingshot homolog 3 OS=Rattus norvegicus GN=Ssh3 PE=2 SV=1 Back     alignment and function description
>sp|Q8TE77|SSH3_HUMAN Protein phosphatase Slingshot homolog 3 OS=Homo sapiens GN=SSH3 PE=1 SV=2 Back     alignment and function description
>sp|Q556Y8|DUSPR_DICDI Probable rhodanese domain-containing dual specificity protein phosphatase OS=Dictyostelium discoideum GN=DDB_G0273199 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
345494048 1279 PREDICTED: hypothetical protein LOC10012 0.910 0.087 0.794 3e-52
157134038 1431 slingshot dual specificity phosphatase [ 0.910 0.078 0.812 4e-52
357603651 960 putative slingshot dual specificity phos 0.910 0.116 0.794 8e-52
307196600 1067 Protein phosphatase Slingshot [Harpegnat 0.910 0.104 0.794 2e-51
332025018 1053 Protein phosphatase Slingshot [Acromyrme 0.910 0.106 0.794 3e-51
322787076 922 hypothetical protein SINV_15540 [Solenop 0.910 0.121 0.794 3e-51
307170871 1024 Protein phosphatase Slingshot [Camponotu 0.910 0.109 0.794 4e-51
383854174 1191 PREDICTED: uncharacterized protein LOC10 0.910 0.094 0.785 4e-51
350423294 1203 PREDICTED: hypothetical protein LOC10074 0.910 0.093 0.785 6e-51
340719097 1199 PREDICTED: hypothetical protein LOC10065 0.910 0.093 0.785 6e-51
>gi|345494048|ref|XP_001606169.2| PREDICTED: hypothetical protein LOC100122558 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  208 bits (530), Expect = 3e-52,   Method: Composition-based stats.
 Identities = 89/112 (79%), Positives = 104/112 (92%)

Query: 2   DGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVH 61
           +GV HILNVTREIDNFFPG+F+Y N+RVYDD+KTDLLKHWDNT+KYIT AK +GSKVLVH
Sbjct: 316 NGVRHILNVTREIDNFFPGMFNYLNVRVYDDEKTDLLKHWDNTFKYITKAKKEGSKVLVH 375

Query: 62  CKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQ 113
           CKMG+SRSASVVIAYAMKAYNWD ++A+ HV+ KRNCIKPN +F++QLETYQ
Sbjct: 376 CKMGVSRSASVVIAYAMKAYNWDFSQALKHVKDKRNCIKPNNSFLSQLETYQ 427




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157134038|ref|XP_001656311.1| slingshot dual specificity phosphatase [Aedes aegypti] gi|108870638|gb|EAT34863.1| AAEL012935-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|357603651|gb|EHJ63863.1| putative slingshot dual specificity phosphatase [Danaus plexippus] Back     alignment and taxonomy information
>gi|307196600|gb|EFN78106.1| Protein phosphatase Slingshot [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332025018|gb|EGI65205.1| Protein phosphatase Slingshot [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322787076|gb|EFZ13300.1| hypothetical protein SINV_15540 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307170871|gb|EFN62982.1| Protein phosphatase Slingshot [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383854174|ref|XP_003702597.1| PREDICTED: uncharacterized protein LOC100877919 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350423294|ref|XP_003493434.1| PREDICTED: hypothetical protein LOC100748426 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340719097|ref|XP_003397993.1| PREDICTED: hypothetical protein LOC100651687 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
FB|FBgn0029157 1045 ssh "slingshot" [Drosophila me 0.902 0.106 0.729 1e-42
UNIPROTKB|F1P4Y2456 F1P4Y2 "Uncharacterized protei 0.902 0.243 0.657 1.9e-37
UNIPROTKB|F1NFJ2 719 F1NFJ2 "Uncharacterized protei 0.902 0.154 0.657 9.7e-37
ZFIN|ZDB-GENE-030131-3810 1175 ssh2a "slingshot homolog 2a (D 0.902 0.094 0.657 1.7e-36
RGD|1309389 1390 Ssh2 "slingshot protein phosph 0.902 0.079 0.657 2.9e-36
UNIPROTKB|E1BPN5 1373 SSH2 "Uncharacterized protein" 0.902 0.080 0.657 3.6e-36
UNIPROTKB|F1PIV9 1406 SSH2 "Uncharacterized protein" 0.902 0.078 0.657 3.7e-36
UNIPROTKB|J9NY81 1421 SSH2 "Uncharacterized protein" 0.902 0.078 0.657 3.8e-36
UNIPROTKB|Q76I76 1423 SSH2 "Protein phosphatase Slin 0.902 0.078 0.657 3.8e-36
MGI|MGI:2679255 1423 Ssh2 "slingshot homolog 2 (Dro 0.902 0.078 0.657 3.8e-36
FB|FBgn0029157 ssh "slingshot" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 462 (167.7 bits), Expect = 1.0e-42, P = 1.0e-42
 Identities = 81/111 (72%), Positives = 100/111 (90%)

Query:     2 DGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVH 61
             +GV HILNVTREIDNFFPG F+Y N+RVYDD+KT+LLK+WD+T++YIT AK +GSKVLVH
Sbjct:   408 NGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVH 467

Query:    62 CKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETY 112
             CKMG+SRSASVVIAYAMKAY W+  +A+ HV+++R+CIKPN NF+ QLETY
Sbjct:   468 CKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETY 518




GO:0006470 "protein dephosphorylation" evidence=IBA;NAS
GO:0017017 "MAP kinase tyrosine/serine/threonine phosphatase activity" evidence=IDA;NAS
GO:0008330 "protein tyrosine/threonine phosphatase activity" evidence=NAS
GO:0008138 "protein tyrosine/serine/threonine phosphatase activity" evidence=ISS;NAS
GO:0030036 "actin cytoskeleton organization" evidence=NAS
GO:0008064 "regulation of actin polymerization or depolymerization" evidence=IMP
GO:0005856 "cytoskeleton" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0004725 "protein tyrosine phosphatase activity" evidence=IEA
GO:0050770 "regulation of axonogenesis" evidence=IMP
GO:0016319 "mushroom body development" evidence=IMP
GO:0010591 "regulation of lamellipodium assembly" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=IMP
GO:0048749 "compound eye development" evidence=IGI
GO:0003779 "actin binding" evidence=IBA
GO:0005737 "cytoplasm" evidence=IBA
UNIPROTKB|F1P4Y2 F1P4Y2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFJ2 F1NFJ2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3810 ssh2a "slingshot homolog 2a (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1309389 Ssh2 "slingshot protein phosphatase 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPN5 SSH2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PIV9 SSH2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NY81 SSH2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q76I76 SSH2 "Protein phosphatase Slingshot homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2679255 Ssh2 "slingshot homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5SW75SSH2_MOUSE3, ., 1, ., 3, ., 4, 80.65760.90240.0780yesN/A
Q6NN85SSH_DROME3, ., 1, ., 3, ., 4, 80.72970.90240.1062yesN/A
Q76I76SSH2_HUMAN3, ., 1, ., 3, ., 4, 80.65760.90240.0780yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.737
3rd Layer3.1.30.691
3rd Layer3.1.3.480.737

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
cd00127139 cd00127, DSPc, Dual specificity phosphatases (DSP) 5e-39
smart00195138 smart00195, DSPc, Dual specificity phosphatase, ca 6e-39
pfam00782131 pfam00782, DSPc, Dual specificity phosphatase, cat 1e-33
COG2453180 COG2453, CDC14, Predicted protein-tyrosine phospha 1e-12
PRK12361 547 PRK12361, PRK12361, hypothetical protein; Provisio 3e-05
COG5350172 COG5350, COG5350, Predicted protein tyrosine phosp 5e-04
>gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
 Score =  127 bits (321), Expect = 5e-39
 Identities = 46/113 (40%), Positives = 68/113 (60%), Gaps = 2/113 (1%)

Query: 3   GVCHILNVTREI--DNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLV 60
           G+ H+LNV +E+  +N F   F+Y  + + D    D+ K++D    +I  A+ +G KVLV
Sbjct: 27  GITHVLNVAKEVPNENLFLSDFNYLYVPILDLPSQDISKYFDEAVDFIDDAREKGGKVLV 86

Query: 61  HCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQ 113
           HC  G+SRSA++VIAY MK     L  A   V+ +R  I PNA F+ QL+ Y+
Sbjct: 87  HCLAGVSRSATLVIAYLMKTLGLSLREAYEFVKSRRPIISPNAGFMRQLKEYE 139


Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139

>gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|227653 COG5350, COG5350, Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
KOG1718|consensus198 100.0
smart00195138 DSPc Dual specificity phosphatase, catalytic domai 100.0
PF00782133 DSPc: Dual specificity phosphatase, catalytic doma 100.0
KOG1716|consensus285 99.98
KOG1717|consensus343 99.98
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr 99.97
PRK12361 547 hypothetical protein; Provisional 99.95
PTZ00242166 protein tyrosine phosphatase; Provisional 99.94
PTZ00393241 protein tyrosine phosphatase; Provisional 99.94
KOG1719|consensus183 99.92
KOG1720|consensus225 99.89
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Sign 99.85
PF05706168 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) 99.63
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 99.59
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 99.59
KOG2836|consensus173 99.57
PF03162164 Y_phosphatase2: Tyrosine phosphatase family; Inter 99.45
TIGR01244135 conserved hypothetical protein TIGR01244. No membe 99.41
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 99.4
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 99.39
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 99.38
COG5350172 Predicted protein tyrosine phosphatase [General fu 99.24
PHA02742303 protein tyrosine phosphatase; Provisional 99.19
PHA02747312 protein tyrosine phosphatase; Provisional 99.13
PLN02727 986 NAD kinase 99.13
PHA02740298 protein tyrosine phosphatase; Provisional 99.09
PF13350164 Y_phosphatase3: Tyrosine phosphatase family; PDB: 99.09
PHA02746323 protein tyrosine phosphatase; Provisional 99.08
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 99.08
PF14566149 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 99.0
PHA02738320 hypothetical protein; Provisional 98.98
KOG2283|consensus 434 98.96
PF04179451 Init_tRNA_PT: Initiator tRNA phosphoribosyl transf 98.96
PF04273110 DUF442: Putative phosphatase (DUF442); InterPro: I 98.95
KOG2386|consensus 393 98.93
KOG0792|consensus1144 98.92
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 98.92
KOG0790|consensus600 98.76
COG3453130 Uncharacterized protein conserved in bacteria [Fun 98.48
KOG0789|consensus415 98.47
COG2365249 Protein tyrosine/serine phosphatase [Signal transd 98.44
KOG0791|consensus374 98.42
KOG1572|consensus249 98.26
KOG4228|consensus 1087 98.1
KOG0793|consensus1004 97.98
KOG4228|consensus1087 97.8
PF14671141 DSPn: Dual specificity protein phosphatase, N-term 97.51
KOG4471|consensus 717 96.83
PF06602353 Myotub-related: Myotubularin-like phosphatase doma 95.15
KOG1089|consensus 573 94.29
COG0607110 PspE Rhodanese-related sulfurtransferase [Inorgani 94.22
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain 93.92
cd01520128 RHOD_YbbB Member of the Rhodanese Homology Domain 92.68
cd01443113 Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda 90.41
PF03668284 ATP_bind_2: P-loop ATPase protein family; InterPro 90.27
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain sup 90.24
PLN02160136 thiosulfate sulfurtransferase 89.29
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Do 88.24
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 86.93
PF00581113 Rhodanese: Rhodanese-like domain This Prosite entr 86.43
TIGR03167 311 tRNA_sel_U_synt tRNA 2-selenouridine synthase. The 86.41
PF0386156 ANTAR: ANTAR domain; InterPro: IPR005561 ANTAR (Am 85.46
TIGR03642124 cas_csx13 CRISPR-associated protein, Csx13 family. 85.1
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain sup 85.09
cd01531113 Acr2p Eukaryotic arsenate resistance proteins are 84.94
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domai 84.56
PRK00142314 putative rhodanese-related sulfurtransferase; Prov 84.52
PRK10886196 DnaA initiator-associating protein DiaA; Provision 84.19
TIGR03865162 PQQ_CXXCW PQQ-dependent catabolism-associated CXXC 83.73
cd0153292 4RHOD_Repeat_1 Member of the Rhodanese Homology Do 83.61
PRK01415247 hypothetical protein; Validated 83.51
PRK05320257 rhodanese superfamily protein; Provisional 83.51
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Do 80.87
cd01448122 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), 80.39
>KOG1718|consensus Back     alignment and domain information
Probab=100.00  E-value=7.8e-36  Score=197.78  Aligned_cols=120  Identities=33%  Similarity=0.449  Sum_probs=115.9

Q ss_pred             CCCCeEEEEcCCCCCCCCCCcceEEEEEeccCCCccHHHHHHHHHHHHHHHHhCCCeEEEEeCCCCchhHHHHHHHHHHH
Q psy6369           1 MDGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKA   80 (123)
Q Consensus         1 ~~gI~~iin~~~~~~~~~~~~i~~~~ipi~d~~~~~~~~~~~~~~~~i~~~~~~~~~vlVHC~~G~~Rs~~~~~ayl~~~   80 (123)
                      .+||++|||.+.|.++..-.+++|..+|+.|.+...+.++|+.+.+.|+....+||++||||.+|++||+++|+||||++
T Consensus        40 ~~~It~IiNat~E~pn~~l~~~qy~kv~~~D~p~~~l~~hfD~vAD~I~~v~~~gG~TLvHC~AGVSRSAsLClAYLmK~  119 (198)
T KOG1718|consen   40 KRKITCIINATTEVPNTSLPDIQYMKVPLEDTPQARLYDHFDPVADKIHSVIMRGGKTLVHCVAGVSRSASLCLAYLMKY  119 (198)
T ss_pred             hcCceEEEEcccCCCCccCCCceeEEEEcccCCcchhhhhhhHHHHHHHHHHhcCCcEEEEEccccchhHHHHHHHHHHH
Confidence            47999999999999998888899999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCHHHHHHHHHhhCCCCCCCHHHHHHHHHHHhhhcccc
Q psy6369          81 YNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSL  120 (123)
Q Consensus        81 ~~~~~~~a~~~v~~~rp~~~~~~~~~~~L~~~~~~l~~~~  120 (123)
                      .++++.||+.++|++||.++||.+|.+||.+||++|..+.
T Consensus       120 ~~msLreAy~~vKa~RpiIRPN~GFw~QLi~YE~qL~g~~  159 (198)
T KOG1718|consen  120 HCMSLREAYHWVKARRPIIRPNVGFWRQLIDYEQQLFGNA  159 (198)
T ss_pred             ccchHHHHHHHHHhhCceeCCCccHHHHHHHHHHHhcCCC
Confidence            9999999999999999999999999999999999998764



>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>KOG1716|consensus Back     alignment and domain information
>KOG1717|consensus Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PTZ00393 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG1719|consensus Back     alignment and domain information
>KOG1720|consensus Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>TIGR01244 conserved hypothetical protein TIGR01244 Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PLN02727 NAD kinase Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>KOG2283|consensus Back     alignment and domain information
>PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 Back     alignment and domain information
>PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function Back     alignment and domain information
>KOG2386|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>KOG1572|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A Back     alignment and domain information
>KOG4471|consensus Back     alignment and domain information
>PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO Back     alignment and domain information
>KOG1089|consensus Back     alignment and domain information
>COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily Back     alignment and domain information
>PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>PLN02160 thiosulfate sulfurtransferase Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family Back     alignment and domain information
>TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase Back     alignment and domain information
>PF03861 ANTAR: ANTAR domain; InterPro: IPR005561 ANTAR (AmiR and NasR transcription antitermination regulators) is an RNA-binding domain found in bacterial transcription antitermination regulatory proteins [] Back     alignment and domain information
>TIGR03642 cas_csx13 CRISPR-associated protein, Csx13 family Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK00142 putative rhodanese-related sulfurtransferase; Provisional Back     alignment and domain information
>PRK10886 DnaA initiator-associating protein DiaA; Provisional Back     alignment and domain information
>TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein Back     alignment and domain information
>cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 Back     alignment and domain information
>PRK01415 hypothetical protein; Validated Back     alignment and domain information
>PRK05320 rhodanese superfamily protein; Provisional Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
2nt2_A145 Crystal Structure Of Slingshot Phosphatase 2 Length 9e-41
3s4e_A144 Crystal Structrue Of A Novel Mitogen-Activated Prot 2e-18
2r0b_A154 Crystal Structure Of Human Tyrosine Phosphatase-lik 2e-17
1m3g_A145 Solution Structure Of The Catalytic Domain Of Mapk 4e-17
3ezz_A144 Crystal Structure Of Human Mkp-2 Length = 144 3e-15
3lj8_A146 Crystal Structure Of Mkp-4 Length = 146 4e-15
2g6z_A211 Crystal Structure Of Human Dusp5 Length = 211 7e-15
2hcm_A164 Crystal Structure Of Mouse Putative Dual Specificit 3e-14
2hxp_A155 Crystal Structure Of The Human Phosphatase (Dusp9) 4e-14
2oud_A177 Crystal Structure Of The Catalytic Domain Of Human 8e-14
1mkp_A144 Crystal Structure Of Pyst1 (Mkp3) Length = 144 1e-13
1wrm_A165 Crystal Structure Of Jsp-1 Length = 165 3e-13
1zzw_A149 Crystal Structure Of Catalytic Domain Of Human Map 4e-13
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 4e-13
2e0t_A151 Crystal Structure Of Catalytic Domain Of Dual Speci 3e-12
4hrf_A160 Atomic Structure Of Dusp26 Length = 160 2e-11
2gwo_A198 Crystal Structure Of Tmdp Length = 198 6e-11
2pq5_A205 Crystal Structure Of Dual Specificity Protein Phosp 7e-11
2esb_A188 Crystal Structure Of Human Dusp18 Length = 188 3e-10
3f81_A183 Interaction Of Vhr With Sa3 Length = 183 3e-10
1vhr_A184 Human Vh1-Related Dual-Specificity Phosphatase Leng 3e-10
1j4x_A184 Human Vh1-Related Dual-Specificity Phosphatase C124 3e-09
2j16_B182 Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 3e-08
1yz4_A160 Crystal Structure Of Dusp15 Length = 160 9e-08
2y96_A219 Structure Of Human Dual-Specificity Phosphatase 27 2e-07
2j17_A182 Ptyr Bound Form Of Sdp-1 Length = 182 4e-07
2j16_A182 Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 6e-07
2q05_A195 Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FRO 4e-05
2p4d_A172 Structure-Assisted Discovery Of Variola Major H1 Ph 5e-05
2rf6_A176 Crystal Structure Of The Vaccinia Virus Dual-Specif 6e-05
3rgo_A157 Crystal Structure Of Ptpmt1 Length = 157 3e-04
>pdb|2NT2|A Chain A, Crystal Structure Of Slingshot Phosphatase 2 Length = 145 Back     alignment and structure

Iteration: 1

Score = 161 bits (407), Expect = 9e-41, Method: Compositional matrix adjust. Identities = 72/111 (64%), Positives = 90/111 (81%) Query: 3 GVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHC 62 GV +ILNVTREIDNFFPG+F+Y NIRVYD++ TDLL +W++TYK+I+ AK GSK LVH Sbjct: 29 GVRYILNVTREIDNFFPGVFEYHNIRVYDEEATDLLAYWNDTYKFISKAKKHGSKCLVHS 88 Query: 63 KMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQ 113 KMG+SRSAS VIAYAMK Y W+L RA +V+++R KPN +F+ QLE YQ Sbjct: 89 KMGVSRSASTVIAYAMKEYGWNLDRAYDYVKERRTVTKPNPSFMRQLEEYQ 139
>pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 Back     alignment and structure
>pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 Back     alignment and structure
>pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 Back     alignment and structure
>pdb|3EZZ|A Chain A, Crystal Structure Of Human Mkp-2 Length = 144 Back     alignment and structure
>pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 Back     alignment and structure
>pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 Back     alignment and structure
>pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 Back     alignment and structure
>pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 Back     alignment and structure
>pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 Back     alignment and structure
>pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 Back     alignment and structure
>pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 Back     alignment and structure
>pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 Back     alignment and structure
>pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure
>pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 Back     alignment and structure
>pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 Back     alignment and structure
>pdb|2GWO|A Chain A, Crystal Structure Of Tmdp Length = 198 Back     alignment and structure
>pdb|2PQ5|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 13 (Dusp13) Length = 205 Back     alignment and structure
>pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 Back     alignment and structure
>pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 Back     alignment and structure
>pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 Back     alignment and structure
>pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 Back     alignment and structure
>pdb|2J16|B Chain B, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 Back     alignment and structure
>pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 Back     alignment and structure
>pdb|2Y96|A Chain A, Structure Of Human Dual-Specificity Phosphatase 27 Length = 219 Back     alignment and structure
>pdb|2J17|A Chain A, Ptyr Bound Form Of Sdp-1 Length = 182 Back     alignment and structure
>pdb|2J16|A Chain A, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 Back     alignment and structure
>pdb|2Q05|A Chain A, Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FROM VACCINIA VIRUS Wr Length = 195 Back     alignment and structure
>pdb|2P4D|A Chain A, Structure-Assisted Discovery Of Variola Major H1 Phosphatase Inhibitors Length = 172 Back     alignment and structure
>pdb|2RF6|A Chain A, Crystal Structure Of The Vaccinia Virus Dual-Specificity Phosphatase Vh1 Length = 176 Back     alignment and structure
>pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 3e-56
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 1e-55
2hcm_A164 Dual specificity protein phosphatase; structural g 3e-55
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 5e-55
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 9e-55
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 1e-54
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 7e-54
3emu_A161 Leucine rich repeat and phosphatase domain contain 1e-53
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 2e-53
2oud_A177 Dual specificity protein phosphatase 10; A central 4e-53
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 6e-53
2hxp_A155 Dual specificity protein phosphatase 9; human phos 1e-52
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 2e-52
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 3e-52
2q05_A195 Late protein H1, dual specificity protein phosphat 4e-50
3cm3_A176 Late protein H1, dual specificity protein phosphat 6e-50
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 2e-48
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 1e-47
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 3e-47
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 5e-47
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 7e-47
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 5e-45
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 6e-26
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 1e-16
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 1e-13
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 3e-12
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 3e-11
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 6e-11
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 7e-10
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 2e-09
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 3e-09
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 4e-09
1xri_A151 AT1G05000; structural genomics, protein structure 6e-04
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
 Score =  173 bits (439), Expect = 3e-56
 Identities = 36/111 (32%), Positives = 57/111 (51%)

Query: 3   GVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHC 62
            +  +LNV+R           Y  I V D    D+  H+     +I   + +G KVLVH 
Sbjct: 31  HITALLNVSRRTSEACMTHLHYKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHS 90

Query: 63  KMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQ 113
           + GISRS ++ +AY MK   + L  A  +++Q+R+ + PN  F+ QL  Y+
Sbjct: 91  EAGISRSPTICMAYLMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYE 141


>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
3emu_A161 Leucine rich repeat and phosphatase domain contain 100.0
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta 100.0
3s4e_A144 Dual specificity protein phosphatase 19; PTP, prot 100.0
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/bet 100.0
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydro 100.0
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, 100.0
2esb_A188 Dual specificity protein phosphatase 18; alpha/bet 100.0
2hxp_A155 Dual specificity protein phosphatase 9; human phos 100.0
2hcm_A164 Dual specificity protein phosphatase; structural g 100.0
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta 100.0
2r0b_A154 Serine/threonine/tyrosine-interacting protein; str 100.0
2oud_A177 Dual specificity protein phosphatase 10; A central 100.0
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUS 100.0
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, 100.0
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isofo 100.0
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrola 100.0
2e0t_A151 Dual specificity phosphatase 26; conserved hypothe 100.0
3cm3_A176 Late protein H1, dual specificity protein phosphat 100.0
3rgo_A157 Protein-tyrosine phosphatase mitochondrial 1; phos 99.98
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase 99.98
2y96_A219 Dual specificity phosphatase DUPD1; hydrolase; 2.3 99.97
2q05_A195 Late protein H1, dual specificity protein phosphat 99.97
4erc_A150 Dual specificity protein phosphatase 23; alpha bet 99.96
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 99.96
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphospha 99.94
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual spe 99.94
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.93
2c46_A241 MRNA capping enzyme; phosphatase, transferase, hyd 99.93
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine p 99.93
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 99.93
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 99.92
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 99.92
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 99.9
1xri_A151 AT1G05000; structural genomics, protein structure 99.81
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phos 99.8
3v0d_A 339 Voltage-sensor containing phosphatase; PTP, hydrol 99.77
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase- 99.75
2f46_A156 Hypothetical protein; structural genomics, joint c 99.63
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 99.48
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 99.48
3mmj_A314 MYO-inositol hexaphosphate phosphohydrolase; phyta 99.46
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 99.46
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 99.44
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 99.42
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 99.4
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 99.4
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 99.39
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 99.39
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 99.38
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 99.38
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 99.37
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 99.37
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 99.37
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 99.37
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 99.36
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 99.36
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 99.36
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 99.35
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 99.35
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 99.33
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 99.32
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 99.32
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 99.31
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 99.3
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphata 99.29
4i8n_A354 Tyrosine-protein phosphatase non-receptor type 1; 99.28
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydr 99.28
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 99.26
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four str 99.25
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.23
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 99.22
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphata 99.21
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 99.18
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.18
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 99.16
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 99.15
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.15
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 99.15
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 99.12
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 99.09
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 99.06
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 99.03
2nlk_A627 Protein tyrosine phosphatase, receptor type, G VA 99.0
1ohe_A 348 CDC14B, CDC14B2 phosphatase; protein phosphatase, 98.15
2yf0_A 512 Myotubularin-related protein 6; hydrolase; 2.65A { 95.4
1zsq_A 528 Myotubularin-related protein 2; protein-phospholip 94.91
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 94.4
3f4a_A169 Uncharacterized protein YGR203W; protein phosphata 91.6
1vee_A134 Proline-rich protein family; hypothetical protein, 89.09
3hzu_A 318 Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, 88.63
1gmx_A108 GLPE protein; transferase, rhodanese, sulfurtransf 87.57
3flh_A124 Uncharacterized protein LP_1913; alpha-beta protei 85.93
3g5j_A134 Putative ATP/GTP binding protein; N-terminal domai 85.43
3sxu_A150 DNA polymerase III subunit CHI; DNA replication, C 85.39
2jtq_A85 Phage shock protein E; solution structure rhodanes 85.37
2fsx_A148 RV0390, COG0607: rhodanese-related sulfurtransfera 85.22
2hhg_A139 Hypothetical protein RPA3614; MCSG, structural gen 84.89
3iwh_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 83.81
1qxn_A137 SUD, sulfide dehydrogenase; polysulfide-sulfur tra 83.66
3foj_A100 Uncharacterized protein; protein SSP1007, structur 81.98
3eme_A103 Rhodanese-like domain protein; alpha-beta-alpha sa 81.0
1d0q_A103 DNA primase; zinc-binding motif, protein, transfer 80.37
3gk5_A108 Uncharacterized rhodanese-related protein TVG08686 80.31
3olh_A302 MST, 3-mercaptopyruvate sulfurtransferase; structu 80.26
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
Probab=100.00  E-value=2.2e-37  Score=207.39  Aligned_cols=119  Identities=20%  Similarity=0.328  Sum_probs=107.8

Q ss_pred             CCCeEEEEcCCCCCCCCCCcceEEEEEeccCCCccHHHHHHHHHHHHHHHHhCCCeEEEEeCCCCchhHHHHHHHHHHHc
Q psy6369           2 DGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAY   81 (123)
Q Consensus         2 ~gI~~iin~~~~~~~~~~~~i~~~~ipi~d~~~~~~~~~~~~~~~~i~~~~~~~~~vlVHC~~G~~Rs~~~~~ayl~~~~   81 (123)
                      +||++|||++.+.++.++.+++|+++|+.|.+..++.++|+++++||++++.+|++|||||.+|+|||+++++||||...
T Consensus        34 ~gIt~Vlnl~~~~~~~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~~~~VlVHC~~G~sRS~~vv~ayLm~~~  113 (161)
T 3emu_A           34 NNISSILLVGIEVPSLFKDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRSIQRKEGVLIISGTGVNKAPAIVIAFLMYYQ  113 (161)
T ss_dssp             TTEEEEEEEC-------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHHHHTTCEEEEEESSSSSHHHHHHHHHHHHHT
T ss_pred             CCCCEEEEeCCCCccccCCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHHHhcCCeEEEEcCCCCcHHHHHHHHHHHHHh
Confidence            69999999999888888888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHhhCCCCCCCHHHHHHHHHHHhhhcccc
Q psy6369          82 NWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSL  120 (123)
Q Consensus        82 ~~~~~~a~~~v~~~rp~~~~~~~~~~~L~~~~~~l~~~~  120 (123)
                      +|++++|+++|+++||.+.||.+|++||.+||++|..+.
T Consensus       114 ~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L~~~~  152 (161)
T 3emu_A          114 RLSFINAFNKVQGLYPLIDIESGFILQLKLFEKKLEKMN  152 (161)
T ss_dssp             TCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHHHHHhcCC
Confidence            999999999999999999999999999999999987653



>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A Back     alignment and structure
>3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure
>3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* Back     alignment and structure
>1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A Back     alignment and structure
>3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A Back     alignment and structure
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A Back     alignment and structure
>3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A Back     alignment and structure
>3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} Back     alignment and structure
>3sxu_A DNA polymerase III subunit CHI; DNA replication, CHI binds to SSB and PSI, transferase; HET: DNA; 1.85A {Escherichia coli} SCOP: c.128.1.1 PDB: 1em8_A* Back     alignment and structure
>2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A Back     alignment and structure
>2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A Back     alignment and structure
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 Back     alignment and structure
>3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>1d0q_A DNA primase; zinc-binding motif, protein, transferase; HET: DNA; 1.71A {Geobacillus stearothermophilus} SCOP: g.41.3.2 Back     alignment and structure
>3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} Back     alignment and structure
>3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 123
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 2e-28
d1mkpa_144 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien 1e-25
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phospha 6e-23
d1i9sa_194 c.45.1.1 (A:) mRNA capping enzyme, triphosphatase 2e-20
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase 3e-16
d1fpza_176 c.45.1.1 (A:) Kinase associated phosphatase (kap) 6e-12
d1d5ra2174 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase 2e-09
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 1e-07
d1xria_151 c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal 2e-04
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 0.004
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pac-1 [TaxId: 9606]
 Score = 99.0 bits (246), Expect = 2e-28
 Identities = 40/111 (36%), Positives = 63/111 (56%)

Query: 3   GVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHC 62
           G+  +LNV+    N F G+F Y +I V D+   ++   +     +I   KN G +VLVH 
Sbjct: 29  GITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVLVHS 88

Query: 63  KMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQ 113
           + GISRSA++ +AY M++    L  A   V+Q+R  I PN +F+ QL  ++
Sbjct: 89  QAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFE 139


>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d1m3ga_145 Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax 100.0
d1mkpa_144 Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp 100.0
d1vhra_178 VH1-related dual-specificity phosphatase, VHR {Hum 100.0
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 99.94
d1fpza_176 Kinase associated phosphatase (kap) {Human (Homo s 99.93
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 99.93
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 99.91
d1d5ra2174 Phoshphoinositide phosphatase Pten (Pten tumor sup 99.82
d1xria_151 Putative phosphatase At1g05000 {Thale cress (Arabi 99.65
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 99.34
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.31
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 99.24
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 99.2
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 99.19
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 99.1
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 99.09
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 99.09
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 99.04
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 99.0
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 99.0
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 99.0
d1ywfa1272 Phosphotyrosine protein phosphatase PtpB {Mycobact 98.99
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 98.97
d1ohea1157 Proline directed phosphatase CDC14b2 {Human (Homo 97.68
d1zsqa2 387 Myotubularin-related protein 2, C-terminal domain 95.56
d1tq1a_119 Thiosulfate sulfurtransferase/Senescence-associate 90.59
d1yt8a4130 Thiosulfate sulfurtransferase PA2603 {Pseudomonas 84.23
d1urha2120 3-mercaptopyruvate sulfurtransferase {Escherichia 81.49
d1rhsa2144 Rhodanese {Cow (Bos taurus) [TaxId: 9913]} 80.87
d1gmxa_108 Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 80.22
d1qxna_137 Polysulfide-sulfur transferase (sulfide dehydrogen 80.05
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Dual specificity phosphatase-like
domain: Mapk phosphatase
species: Human (Homo sapiens), pac-1 [TaxId: 9606]
Probab=100.00  E-value=8.1e-38  Score=204.83  Aligned_cols=116  Identities=35%  Similarity=0.597  Sum_probs=111.2

Q ss_pred             CCCeEEEEcCCCCCCCCCCcceEEEEEeccCCCccHHHHHHHHHHHHHHHHhCCCeEEEEeCCCCchhHHHHHHHHHHHc
Q psy6369           2 DGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAY   81 (123)
Q Consensus         2 ~gI~~iin~~~~~~~~~~~~i~~~~ipi~d~~~~~~~~~~~~~~~~i~~~~~~~~~vlVHC~~G~~Rs~~~~~ayl~~~~   81 (123)
                      +||++|||++.+.+...++.+.|+++|+.|.+..++.+.|+++++||++..++|++|||||.+|+|||+++++||||.+.
T Consensus        28 ~gI~~Iin~~~~~~~~~~~~~~y~~i~i~D~~~~~i~~~~~~~~~~i~~~~~~~~~VlVHC~~G~sRS~~v~~aYLm~~~  107 (145)
T d1m3ga_          28 CGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVLVHSQAGISRSATICLAYLMQSR  107 (145)
T ss_dssp             HTCSEEEECSSSSSEEECSSSEEEECCCCCSTTCCCTTSHHHHHHHHHHHHHTTCCEEECCSSSSSHHHHHHHHHHHHTT
T ss_pred             cCCcEEEEecCCCCcCCCCceEEEEEeccCCchhhHHHHHHHHHHHHHHhhccCceEEEEcccccccHHHHHHHHHHHHh
Confidence            69999999999988888888999999999998888889999999999999999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHhhCCCCCCCHHHHHHHHHHHhhhc
Q psy6369          82 NWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQ  117 (123)
Q Consensus        82 ~~~~~~a~~~v~~~rp~~~~~~~~~~~L~~~~~~l~  117 (123)
                      +|++++|+++|+++||.+.||.+|.+||.+||++|-
T Consensus       108 ~~~~~~A~~~v~~~Rp~v~pn~~f~~qL~~~e~~l~  143 (145)
T d1m3ga_         108 RVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQVL  143 (145)
T ss_dssp             CCHHHHHHHHHSCSCCCCSSCSSCCCCSHHHHHHHT
T ss_pred             CCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHhc
Confidence            999999999999999999999999999999999875



>d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Back     information, alignment and structure
>d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure