Psyllid ID: psy6369
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| 345494048 | 1279 | PREDICTED: hypothetical protein LOC10012 | 0.910 | 0.087 | 0.794 | 3e-52 | |
| 157134038 | 1431 | slingshot dual specificity phosphatase [ | 0.910 | 0.078 | 0.812 | 4e-52 | |
| 357603651 | 960 | putative slingshot dual specificity phos | 0.910 | 0.116 | 0.794 | 8e-52 | |
| 307196600 | 1067 | Protein phosphatase Slingshot [Harpegnat | 0.910 | 0.104 | 0.794 | 2e-51 | |
| 332025018 | 1053 | Protein phosphatase Slingshot [Acromyrme | 0.910 | 0.106 | 0.794 | 3e-51 | |
| 322787076 | 922 | hypothetical protein SINV_15540 [Solenop | 0.910 | 0.121 | 0.794 | 3e-51 | |
| 307170871 | 1024 | Protein phosphatase Slingshot [Camponotu | 0.910 | 0.109 | 0.794 | 4e-51 | |
| 383854174 | 1191 | PREDICTED: uncharacterized protein LOC10 | 0.910 | 0.094 | 0.785 | 4e-51 | |
| 350423294 | 1203 | PREDICTED: hypothetical protein LOC10074 | 0.910 | 0.093 | 0.785 | 6e-51 | |
| 340719097 | 1199 | PREDICTED: hypothetical protein LOC10065 | 0.910 | 0.093 | 0.785 | 6e-51 |
| >gi|345494048|ref|XP_001606169.2| PREDICTED: hypothetical protein LOC100122558 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 208 bits (530), Expect = 3e-52, Method: Composition-based stats.
Identities = 89/112 (79%), Positives = 104/112 (92%)
Query: 2 DGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVH 61
+GV HILNVTREIDNFFPG+F+Y N+RVYDD+KTDLLKHWDNT+KYIT AK +GSKVLVH
Sbjct: 316 NGVRHILNVTREIDNFFPGMFNYLNVRVYDDEKTDLLKHWDNTFKYITKAKKEGSKVLVH 375
Query: 62 CKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQ 113
CKMG+SRSASVVIAYAMKAYNWD ++A+ HV+ KRNCIKPN +F++QLETYQ
Sbjct: 376 CKMGVSRSASVVIAYAMKAYNWDFSQALKHVKDKRNCIKPNNSFLSQLETYQ 427
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157134038|ref|XP_001656311.1| slingshot dual specificity phosphatase [Aedes aegypti] gi|108870638|gb|EAT34863.1| AAEL012935-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|357603651|gb|EHJ63863.1| putative slingshot dual specificity phosphatase [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|307196600|gb|EFN78106.1| Protein phosphatase Slingshot [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|332025018|gb|EGI65205.1| Protein phosphatase Slingshot [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|322787076|gb|EFZ13300.1| hypothetical protein SINV_15540 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307170871|gb|EFN62982.1| Protein phosphatase Slingshot [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383854174|ref|XP_003702597.1| PREDICTED: uncharacterized protein LOC100877919 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350423294|ref|XP_003493434.1| PREDICTED: hypothetical protein LOC100748426 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340719097|ref|XP_003397993.1| PREDICTED: hypothetical protein LOC100651687 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 123 | ||||||
| FB|FBgn0029157 | 1045 | ssh "slingshot" [Drosophila me | 0.902 | 0.106 | 0.729 | 1e-42 | |
| UNIPROTKB|F1P4Y2 | 456 | F1P4Y2 "Uncharacterized protei | 0.902 | 0.243 | 0.657 | 1.9e-37 | |
| UNIPROTKB|F1NFJ2 | 719 | F1NFJ2 "Uncharacterized protei | 0.902 | 0.154 | 0.657 | 9.7e-37 | |
| ZFIN|ZDB-GENE-030131-3810 | 1175 | ssh2a "slingshot homolog 2a (D | 0.902 | 0.094 | 0.657 | 1.7e-36 | |
| RGD|1309389 | 1390 | Ssh2 "slingshot protein phosph | 0.902 | 0.079 | 0.657 | 2.9e-36 | |
| UNIPROTKB|E1BPN5 | 1373 | SSH2 "Uncharacterized protein" | 0.902 | 0.080 | 0.657 | 3.6e-36 | |
| UNIPROTKB|F1PIV9 | 1406 | SSH2 "Uncharacterized protein" | 0.902 | 0.078 | 0.657 | 3.7e-36 | |
| UNIPROTKB|J9NY81 | 1421 | SSH2 "Uncharacterized protein" | 0.902 | 0.078 | 0.657 | 3.8e-36 | |
| UNIPROTKB|Q76I76 | 1423 | SSH2 "Protein phosphatase Slin | 0.902 | 0.078 | 0.657 | 3.8e-36 | |
| MGI|MGI:2679255 | 1423 | Ssh2 "slingshot homolog 2 (Dro | 0.902 | 0.078 | 0.657 | 3.8e-36 |
| FB|FBgn0029157 ssh "slingshot" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 462 (167.7 bits), Expect = 1.0e-42, P = 1.0e-42
Identities = 81/111 (72%), Positives = 100/111 (90%)
Query: 2 DGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVH 61
+GV HILNVTREIDNFFPG F+Y N+RVYDD+KT+LLK+WD+T++YIT AK +GSKVLVH
Sbjct: 408 NGVRHILNVTREIDNFFPGTFEYFNVRVYDDEKTNLLKYWDDTFRYITRAKAEGSKVLVH 467
Query: 62 CKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETY 112
CKMG+SRSASVVIAYAMKAY W+ +A+ HV+++R+CIKPN NF+ QLETY
Sbjct: 468 CKMGVSRSASVVIAYAMKAYQWEFQQALEHVKKRRSCIKPNKNFLNQLETY 518
|
|
| UNIPROTKB|F1P4Y2 F1P4Y2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NFJ2 F1NFJ2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-3810 ssh2a "slingshot homolog 2a (Drosophila)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1309389 Ssh2 "slingshot protein phosphatase 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BPN5 SSH2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PIV9 SSH2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NY81 SSH2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q76I76 SSH2 "Protein phosphatase Slingshot homolog 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2679255 Ssh2 "slingshot homolog 2 (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 123 | |||
| cd00127 | 139 | cd00127, DSPc, Dual specificity phosphatases (DSP) | 5e-39 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 6e-39 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 1e-33 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 1e-12 | |
| PRK12361 | 547 | PRK12361, PRK12361, hypothetical protein; Provisio | 3e-05 | |
| COG5350 | 172 | COG5350, COG5350, Predicted protein tyrosine phosp | 5e-04 |
| >gnl|CDD|238073 cd00127, DSPc, Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
Score = 127 bits (321), Expect = 5e-39
Identities = 46/113 (40%), Positives = 68/113 (60%), Gaps = 2/113 (1%)
Query: 3 GVCHILNVTREI--DNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLV 60
G+ H+LNV +E+ +N F F+Y + + D D+ K++D +I A+ +G KVLV
Sbjct: 27 GITHVLNVAKEVPNENLFLSDFNYLYVPILDLPSQDISKYFDEAVDFIDDAREKGGKVLV 86
Query: 61 HCKMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQ 113
HC G+SRSA++VIAY MK L A V+ +R I PNA F+ QL+ Y+
Sbjct: 87 HCLAGVSRSATLVIAYLMKTLGLSLREAYEFVKSRRPIISPNAGFMRQLKEYE 139
|
Structurally similar to tyrosine-specific phosphatases but with a shallower active site cleft and a distinctive active site signature motif, HCxxGxxR. Characterized as VHR- or Cdc25-like. Length = 139 |
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227653 COG5350, COG5350, Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| KOG1718|consensus | 198 | 100.0 | ||
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 100.0 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 100.0 | |
| KOG1716|consensus | 285 | 99.98 | ||
| KOG1717|consensus | 343 | 99.98 | ||
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 99.97 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 99.95 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 99.94 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 99.94 | |
| KOG1719|consensus | 183 | 99.92 | ||
| KOG1720|consensus | 225 | 99.89 | ||
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 99.85 | |
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 99.63 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.59 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.59 | |
| KOG2836|consensus | 173 | 99.57 | ||
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 99.45 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 99.41 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 99.4 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 99.39 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 99.38 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 99.24 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 99.19 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 99.13 | |
| PLN02727 | 986 | NAD kinase | 99.13 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 99.09 | |
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 99.09 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 99.08 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 99.08 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 99.0 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 98.98 | |
| KOG2283|consensus | 434 | 98.96 | ||
| PF04179 | 451 | Init_tRNA_PT: Initiator tRNA phosphoribosyl transf | 98.96 | |
| PF04273 | 110 | DUF442: Putative phosphatase (DUF442); InterPro: I | 98.95 | |
| KOG2386|consensus | 393 | 98.93 | ||
| KOG0792|consensus | 1144 | 98.92 | ||
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 98.92 | |
| KOG0790|consensus | 600 | 98.76 | ||
| COG3453 | 130 | Uncharacterized protein conserved in bacteria [Fun | 98.48 | |
| KOG0789|consensus | 415 | 98.47 | ||
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 98.44 | |
| KOG0791|consensus | 374 | 98.42 | ||
| KOG1572|consensus | 249 | 98.26 | ||
| KOG4228|consensus | 1087 | 98.1 | ||
| KOG0793|consensus | 1004 | 97.98 | ||
| KOG4228|consensus | 1087 | 97.8 | ||
| PF14671 | 141 | DSPn: Dual specificity protein phosphatase, N-term | 97.51 | |
| KOG4471|consensus | 717 | 96.83 | ||
| PF06602 | 353 | Myotub-related: Myotubularin-like phosphatase doma | 95.15 | |
| KOG1089|consensus | 573 | 94.29 | ||
| COG0607 | 110 | PspE Rhodanese-related sulfurtransferase [Inorgani | 94.22 | |
| cd01518 | 101 | RHOD_YceA Member of the Rhodanese Homology Domain | 93.92 | |
| cd01520 | 128 | RHOD_YbbB Member of the Rhodanese Homology Domain | 92.68 | |
| cd01443 | 113 | Cdc25_Acr2p Cdc25 enzymes are members of the Rhoda | 90.41 | |
| PF03668 | 284 | ATP_bind_2: P-loop ATPase protein family; InterPro | 90.27 | |
| cd01522 | 117 | RHOD_1 Member of the Rhodanese Homology Domain sup | 90.24 | |
| PLN02160 | 136 | thiosulfate sulfurtransferase | 89.29 | |
| cd01533 | 109 | 4RHOD_Repeat_2 Member of the Rhodanese Homology Do | 88.24 | |
| PRK05416 | 288 | glmZ(sRNA)-inactivating NTPase; Provisional | 86.93 | |
| PF00581 | 113 | Rhodanese: Rhodanese-like domain This Prosite entr | 86.43 | |
| TIGR03167 | 311 | tRNA_sel_U_synt tRNA 2-selenouridine synthase. The | 86.41 | |
| PF03861 | 56 | ANTAR: ANTAR domain; InterPro: IPR005561 ANTAR (Am | 85.46 | |
| TIGR03642 | 124 | cas_csx13 CRISPR-associated protein, Csx13 family. | 85.1 | |
| cd01528 | 101 | RHOD_2 Member of the Rhodanese Homology Domain sup | 85.09 | |
| cd01531 | 113 | Acr2p Eukaryotic arsenate resistance proteins are | 84.94 | |
| cd01523 | 100 | RHOD_Lact_B Member of the Rhodanese Homology Domai | 84.56 | |
| PRK00142 | 314 | putative rhodanese-related sulfurtransferase; Prov | 84.52 | |
| PRK10886 | 196 | DnaA initiator-associating protein DiaA; Provision | 84.19 | |
| TIGR03865 | 162 | PQQ_CXXCW PQQ-dependent catabolism-associated CXXC | 83.73 | |
| cd01532 | 92 | 4RHOD_Repeat_1 Member of the Rhodanese Homology Do | 83.61 | |
| PRK01415 | 247 | hypothetical protein; Validated | 83.51 | |
| PRK05320 | 257 | rhodanese superfamily protein; Provisional | 83.51 | |
| cd01534 | 95 | 4RHOD_Repeat_3 Member of the Rhodanese Homology Do | 80.87 | |
| cd01448 | 122 | TST_Repeat_1 Thiosulfate sulfurtransferase (TST), | 80.39 |
| >KOG1718|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.8e-36 Score=197.78 Aligned_cols=120 Identities=33% Similarity=0.449 Sum_probs=115.9
Q ss_pred CCCCeEEEEcCCCCCCCCCCcceEEEEEeccCCCccHHHHHHHHHHHHHHHHhCCCeEEEEeCCCCchhHHHHHHHHHHH
Q psy6369 1 MDGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKA 80 (123)
Q Consensus 1 ~~gI~~iin~~~~~~~~~~~~i~~~~ipi~d~~~~~~~~~~~~~~~~i~~~~~~~~~vlVHC~~G~~Rs~~~~~ayl~~~ 80 (123)
.+||++|||.+.|.++..-.+++|..+|+.|.+...+.++|+.+.+.|+....+||++||||.+|++||+++|+||||++
T Consensus 40 ~~~It~IiNat~E~pn~~l~~~qy~kv~~~D~p~~~l~~hfD~vAD~I~~v~~~gG~TLvHC~AGVSRSAsLClAYLmK~ 119 (198)
T KOG1718|consen 40 KRKITCIINATTEVPNTSLPDIQYMKVPLEDTPQARLYDHFDPVADKIHSVIMRGGKTLVHCVAGVSRSASLCLAYLMKY 119 (198)
T ss_pred hcCceEEEEcccCCCCccCCCceeEEEEcccCCcchhhhhhhHHHHHHHHHHhcCCcEEEEEccccchhHHHHHHHHHHH
Confidence 47999999999999998888899999999999999999999999999999999999999999999999999999999999
Q ss_pred cCCCHHHHHHHHHhhCCCCCCCHHHHHHHHHHHhhhcccc
Q psy6369 81 YNWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSL 120 (123)
Q Consensus 81 ~~~~~~~a~~~v~~~rp~~~~~~~~~~~L~~~~~~l~~~~ 120 (123)
.++++.||+.++|++||.++||.+|.+||.+||++|..+.
T Consensus 120 ~~msLreAy~~vKa~RpiIRPN~GFw~QLi~YE~qL~g~~ 159 (198)
T KOG1718|consen 120 HCMSLREAYHWVKARRPIIRPNVGFWRQLIDYEQQLFGNA 159 (198)
T ss_pred ccchHHHHHHHHHhhCceeCCCccHHHHHHHHHHHhcCCC
Confidence 9999999999999999999999999999999999998764
|
|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG1716|consensus | Back alignment and domain information |
|---|
| >KOG1717|consensus | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1719|consensus | Back alignment and domain information |
|---|
| >KOG1720|consensus | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >KOG2836|consensus | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PLN02727 NAD kinase | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2283|consensus | Back alignment and domain information |
|---|
| >PF04179 Init_tRNA_PT: Initiator tRNA phosphoribosyl transferase ; InterPro: IPR007306 This enzyme (2 | Back alignment and domain information |
|---|
| >PF04273 DUF442: Putative phosphatase (DUF442); InterPro: IPR005939 Although this domain is uncharacterised it seems likely that it performs a phosphatase function | Back alignment and domain information |
|---|
| >KOG2386|consensus | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >COG3453 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >KOG1572|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >PF14671 DSPn: Dual specificity protein phosphatase, N-terminal half; PDB: 1OHD_A 1OHE_A 1OHC_A | Back alignment and domain information |
|---|
| >KOG4471|consensus | Back alignment and domain information |
|---|
| >PF06602 Myotub-related: Myotubularin-like phosphatase domain; InterPro: IPR010569 This family represents a region within eukaryotic myotubularin-related proteins that is sometimes found with IPR004182 from INTERPRO | Back alignment and domain information |
|---|
| >KOG1089|consensus | Back alignment and domain information |
|---|
| >COG0607 PspE Rhodanese-related sulfurtransferase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01520 RHOD_YbbB Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01443 Cdc25_Acr2p Cdc25 enzymes are members of the Rhodanese Homology Domain (RHOD) superfamily | Back alignment and domain information |
|---|
| >PF03668 ATP_bind_2: P-loop ATPase protein family; InterPro: IPR005337 This entry represents UPF0042 nucleotide-binding proteins | Back alignment and domain information |
|---|
| >cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 | Back alignment and domain information |
|---|
| >PLN02160 thiosulfate sulfurtransferase | Back alignment and domain information |
|---|
| >cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 | Back alignment and domain information |
|---|
| >PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional | Back alignment and domain information |
|---|
| >PF00581 Rhodanese: Rhodanese-like domain This Prosite entry represents a subset of this family | Back alignment and domain information |
|---|
| >TIGR03167 tRNA_sel_U_synt tRNA 2-selenouridine synthase | Back alignment and domain information |
|---|
| >PF03861 ANTAR: ANTAR domain; InterPro: IPR005561 ANTAR (AmiR and NasR transcription antitermination regulators) is an RNA-binding domain found in bacterial transcription antitermination regulatory proteins [] | Back alignment and domain information |
|---|
| >TIGR03642 cas_csx13 CRISPR-associated protein, Csx13 family | Back alignment and domain information |
|---|
| >cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 | Back alignment and domain information |
|---|
| >cd01531 Acr2p Eukaryotic arsenate resistance proteins are members of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily | Back alignment and domain information |
|---|
| >PRK00142 putative rhodanese-related sulfurtransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10886 DnaA initiator-associating protein DiaA; Provisional | Back alignment and domain information |
|---|
| >TIGR03865 PQQ_CXXCW PQQ-dependent catabolism-associated CXXCW motif protein | Back alignment and domain information |
|---|
| >cd01532 4RHOD_Repeat_1 Member of the Rhodanese Homology Domain superfamily, repeat 1 | Back alignment and domain information |
|---|
| >PRK01415 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK05320 rhodanese superfamily protein; Provisional | Back alignment and domain information |
|---|
| >cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 | Back alignment and domain information |
|---|
| >cd01448 TST_Repeat_1 Thiosulfate sulfurtransferase (TST), N-terminal, inactive domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 123 | ||||
| 2nt2_A | 145 | Crystal Structure Of Slingshot Phosphatase 2 Length | 9e-41 | ||
| 3s4e_A | 144 | Crystal Structrue Of A Novel Mitogen-Activated Prot | 2e-18 | ||
| 2r0b_A | 154 | Crystal Structure Of Human Tyrosine Phosphatase-lik | 2e-17 | ||
| 1m3g_A | 145 | Solution Structure Of The Catalytic Domain Of Mapk | 4e-17 | ||
| 3ezz_A | 144 | Crystal Structure Of Human Mkp-2 Length = 144 | 3e-15 | ||
| 3lj8_A | 146 | Crystal Structure Of Mkp-4 Length = 146 | 4e-15 | ||
| 2g6z_A | 211 | Crystal Structure Of Human Dusp5 Length = 211 | 7e-15 | ||
| 2hcm_A | 164 | Crystal Structure Of Mouse Putative Dual Specificit | 3e-14 | ||
| 2hxp_A | 155 | Crystal Structure Of The Human Phosphatase (Dusp9) | 4e-14 | ||
| 2oud_A | 177 | Crystal Structure Of The Catalytic Domain Of Human | 8e-14 | ||
| 1mkp_A | 144 | Crystal Structure Of Pyst1 (Mkp3) Length = 144 | 1e-13 | ||
| 1wrm_A | 165 | Crystal Structure Of Jsp-1 Length = 165 | 3e-13 | ||
| 1zzw_A | 149 | Crystal Structure Of Catalytic Domain Of Human Map | 4e-13 | ||
| 2wgp_A | 190 | Crystal Structure Of Human Dual Specificity Phospha | 4e-13 | ||
| 2e0t_A | 151 | Crystal Structure Of Catalytic Domain Of Dual Speci | 3e-12 | ||
| 4hrf_A | 160 | Atomic Structure Of Dusp26 Length = 160 | 2e-11 | ||
| 2gwo_A | 198 | Crystal Structure Of Tmdp Length = 198 | 6e-11 | ||
| 2pq5_A | 205 | Crystal Structure Of Dual Specificity Protein Phosp | 7e-11 | ||
| 2esb_A | 188 | Crystal Structure Of Human Dusp18 Length = 188 | 3e-10 | ||
| 3f81_A | 183 | Interaction Of Vhr With Sa3 Length = 183 | 3e-10 | ||
| 1vhr_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase Leng | 3e-10 | ||
| 1j4x_A | 184 | Human Vh1-Related Dual-Specificity Phosphatase C124 | 3e-09 | ||
| 2j16_B | 182 | Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | 3e-08 | ||
| 1yz4_A | 160 | Crystal Structure Of Dusp15 Length = 160 | 9e-08 | ||
| 2y96_A | 219 | Structure Of Human Dual-Specificity Phosphatase 27 | 2e-07 | ||
| 2j17_A | 182 | Ptyr Bound Form Of Sdp-1 Length = 182 | 4e-07 | ||
| 2j16_A | 182 | Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | 6e-07 | ||
| 2q05_A | 195 | Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FRO | 4e-05 | ||
| 2p4d_A | 172 | Structure-Assisted Discovery Of Variola Major H1 Ph | 5e-05 | ||
| 2rf6_A | 176 | Crystal Structure Of The Vaccinia Virus Dual-Specif | 6e-05 | ||
| 3rgo_A | 157 | Crystal Structure Of Ptpmt1 Length = 157 | 3e-04 |
| >pdb|2NT2|A Chain A, Crystal Structure Of Slingshot Phosphatase 2 Length = 145 | Back alignment and structure |
|
| >pdb|3S4E|A Chain A, Crystal Structrue Of A Novel Mitogen-Activated Protein Kinase Phosphatase, Skrp1 Length = 144 | Back alignment and structure |
| >pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-like Serine/threonine/tyrosine-interacting Protein Length = 154 | Back alignment and structure |
| >pdb|1M3G|A Chain A, Solution Structure Of The Catalytic Domain Of Mapk Phosphatase Pac-1: Insights Into Substrate-Induced Enzymatic Activation Length = 145 | Back alignment and structure |
| >pdb|3EZZ|A Chain A, Crystal Structure Of Human Mkp-2 Length = 144 | Back alignment and structure |
| >pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 | Back alignment and structure |
| >pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 | Back alignment and structure |
| >pdb|2HCM|A Chain A, Crystal Structure Of Mouse Putative Dual Specificity Phosphatase Complexed With Zinc Tungstate, New York Structural Genomics Consortium Length = 164 | Back alignment and structure |
| >pdb|2HXP|A Chain A, Crystal Structure Of The Human Phosphatase (Dusp9) Length = 155 | Back alignment and structure |
| >pdb|2OUD|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Mkp5 Length = 177 | Back alignment and structure |
| >pdb|1MKP|A Chain A, Crystal Structure Of Pyst1 (Mkp3) Length = 144 | Back alignment and structure |
| >pdb|1WRM|A Chain A, Crystal Structure Of Jsp-1 Length = 165 | Back alignment and structure |
| >pdb|1ZZW|A Chain A, Crystal Structure Of Catalytic Domain Of Human Map Kinase Phosphatase 5 Length = 149 | Back alignment and structure |
| >pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 | Back alignment and structure |
| >pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 | Back alignment and structure |
| >pdb|4HRF|A Chain A, Atomic Structure Of Dusp26 Length = 160 | Back alignment and structure |
| >pdb|2GWO|A Chain A, Crystal Structure Of Tmdp Length = 198 | Back alignment and structure |
| >pdb|2PQ5|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 13 (Dusp13) Length = 205 | Back alignment and structure |
| >pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 | Back alignment and structure |
| >pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 | Back alignment and structure |
| >pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 | Back alignment and structure |
| >pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 | Back alignment and structure |
| >pdb|2J16|B Chain B, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | Back alignment and structure |
| >pdb|1YZ4|A Chain A, Crystal Structure Of Dusp15 Length = 160 | Back alignment and structure |
| >pdb|2Y96|A Chain A, Structure Of Human Dual-Specificity Phosphatase 27 Length = 219 | Back alignment and structure |
| >pdb|2J17|A Chain A, Ptyr Bound Form Of Sdp-1 Length = 182 | Back alignment and structure |
| >pdb|2J16|A Chain A, Apo & Sulphate Bound Forms Of Sdp-1 Length = 182 | Back alignment and structure |
| >pdb|2Q05|A Chain A, Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FROM VACCINIA VIRUS Wr Length = 195 | Back alignment and structure |
| >pdb|2P4D|A Chain A, Structure-Assisted Discovery Of Variola Major H1 Phosphatase Inhibitors Length = 172 | Back alignment and structure |
| >pdb|2RF6|A Chain A, Crystal Structure Of The Vaccinia Virus Dual-Specificity Phosphatase Vh1 Length = 176 | Back alignment and structure |
| >pdb|3RGO|A Chain A, Crystal Structure Of Ptpmt1 Length = 157 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 123 | |||
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 3e-56 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 1e-55 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 3e-55 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 5e-55 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 9e-55 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 1e-54 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 7e-54 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 1e-53 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 2e-53 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 4e-53 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 6e-53 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 1e-52 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 2e-52 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 3e-52 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 4e-50 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 6e-50 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 2e-48 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 1e-47 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 3e-47 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 5e-47 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 7e-47 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 5e-45 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 6e-26 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 1e-16 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 1e-13 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 3e-12 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 3e-11 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 6e-11 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 7e-10 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 2e-09 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 3e-09 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 4e-09 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 6e-04 |
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
Score = 173 bits (439), Expect = 3e-56
Identities = 36/111 (32%), Positives = 57/111 (51%)
Query: 3 GVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHC 62
+ +LNV+R Y I V D D+ H+ +I + +G KVLVH
Sbjct: 31 HITALLNVSRRTSEACMTHLHYKWIPVEDSHTADISSHFQEAIDFIDCVREKGGKVLVHS 90
Query: 63 KMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQ 113
+ GISRS ++ +AY MK + L A +++Q+R+ + PN F+ QL Y+
Sbjct: 91 EAGISRSPTICMAYLMKTKQFRLKEAFDYIKQRRSMVSPNFGFMGQLLQYE 141
|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Length = 144 | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} Length = 190 | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Length = 161 | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Length = 165 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Length = 177 | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Length = 160 | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A Length = 155 | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Length = 195 | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Length = 176 | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Length = 167 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Length = 189 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Length = 169 | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 100.0 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 100.0 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 100.0 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 100.0 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 100.0 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 100.0 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 100.0 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 100.0 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 100.0 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 100.0 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 100.0 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 100.0 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 100.0 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 100.0 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 100.0 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 100.0 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 100.0 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 100.0 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 99.98 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 99.98 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 99.97 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 99.97 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 99.96 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 99.96 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 99.94 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 99.94 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.93 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 99.93 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 99.93 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 99.93 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.92 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.92 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 99.9 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 99.81 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 99.8 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 99.77 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 99.75 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 99.63 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 99.48 | |
| 3gxh_A | 157 | Putative phosphatase (DUF442); YP_001181608.1, str | 99.48 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 99.46 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 99.46 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 99.44 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 99.42 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 99.4 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 99.4 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 99.39 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 99.39 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 99.38 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 99.38 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 99.37 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 99.37 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 99.37 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 99.37 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 99.36 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 99.36 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 99.36 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 99.35 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 99.35 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 99.33 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 99.32 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 99.32 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 99.31 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 99.3 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.29 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 99.28 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 99.28 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 99.26 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 99.25 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.23 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 99.22 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 99.21 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 99.18 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.18 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 99.16 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 99.15 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 99.15 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.15 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 99.12 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 99.09 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 99.06 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 99.03 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 99.0 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 98.15 | |
| 2yf0_A | 512 | Myotubularin-related protein 6; hydrolase; 2.65A { | 95.4 | |
| 1zsq_A | 528 | Myotubularin-related protein 2; protein-phospholip | 94.91 | |
| 1lw3_A | 657 | Myotubularin-related protein 2; protein-phosphate | 94.4 | |
| 3f4a_A | 169 | Uncharacterized protein YGR203W; protein phosphata | 91.6 | |
| 1vee_A | 134 | Proline-rich protein family; hypothetical protein, | 89.09 | |
| 3hzu_A | 318 | Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, | 88.63 | |
| 1gmx_A | 108 | GLPE protein; transferase, rhodanese, sulfurtransf | 87.57 | |
| 3flh_A | 124 | Uncharacterized protein LP_1913; alpha-beta protei | 85.93 | |
| 3g5j_A | 134 | Putative ATP/GTP binding protein; N-terminal domai | 85.43 | |
| 3sxu_A | 150 | DNA polymerase III subunit CHI; DNA replication, C | 85.39 | |
| 2jtq_A | 85 | Phage shock protein E; solution structure rhodanes | 85.37 | |
| 2fsx_A | 148 | RV0390, COG0607: rhodanese-related sulfurtransfera | 85.22 | |
| 2hhg_A | 139 | Hypothetical protein RPA3614; MCSG, structural gen | 84.89 | |
| 3iwh_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 83.81 | |
| 1qxn_A | 137 | SUD, sulfide dehydrogenase; polysulfide-sulfur tra | 83.66 | |
| 3foj_A | 100 | Uncharacterized protein; protein SSP1007, structur | 81.98 | |
| 3eme_A | 103 | Rhodanese-like domain protein; alpha-beta-alpha sa | 81.0 | |
| 1d0q_A | 103 | DNA primase; zinc-binding motif, protein, transfer | 80.37 | |
| 3gk5_A | 108 | Uncharacterized rhodanese-related protein TVG08686 | 80.31 | |
| 3olh_A | 302 | MST, 3-mercaptopyruvate sulfurtransferase; structu | 80.26 |
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.2e-37 Score=207.39 Aligned_cols=119 Identities=20% Similarity=0.328 Sum_probs=107.8
Q ss_pred CCCeEEEEcCCCCCCCCCCcceEEEEEeccCCCccHHHHHHHHHHHHHHHHhCCCeEEEEeCCCCchhHHHHHHHHHHHc
Q psy6369 2 DGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAY 81 (123)
Q Consensus 2 ~gI~~iin~~~~~~~~~~~~i~~~~ipi~d~~~~~~~~~~~~~~~~i~~~~~~~~~vlVHC~~G~~Rs~~~~~ayl~~~~ 81 (123)
+||++|||++.+.++.++.+++|+++|+.|.+..++.++|+++++||++++.+|++|||||.+|+|||+++++||||...
T Consensus 34 ~gIt~Vlnl~~~~~~~~~~~~~~~~ipi~D~~~~~l~~~~~~~~~fI~~~~~~~~~VlVHC~~G~sRS~~vv~ayLm~~~ 113 (161)
T 3emu_A 34 NNISSILLVGIEVPSLFKDQCDILRLDIVSEEGHQLYDSIPNAIKFIIRSIQRKEGVLIISGTGVNKAPAIVIAFLMYYQ 113 (161)
T ss_dssp TTEEEEEEEC-------CTTSEEEEECCCCSSTTHHHHHHHHHHHHHHHHHHTTCEEEEEESSSSSHHHHHHHHHHHHHT
T ss_pred CCCCEEEEeCCCCccccCCCCEEEEEeCcCCCCCcHHHHHHHHHHHHHHHHhcCCeEEEEcCCCCcHHHHHHHHHHHHHh
Confidence 69999999999888888888999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCHHHHHHHHHhhCCCCCCCHHHHHHHHHHHhhhcccc
Q psy6369 82 NWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQPSL 120 (123)
Q Consensus 82 ~~~~~~a~~~v~~~rp~~~~~~~~~~~L~~~~~~l~~~~ 120 (123)
+|++++|+++|+++||.+.||.+|++||.+||++|..+.
T Consensus 114 ~~s~~~A~~~v~~~Rp~i~pn~~f~~qL~~~e~~L~~~~ 152 (161)
T 3emu_A 114 RLSFINAFNKVQGLYPLIDIESGFILQLKLFEKKLEKMN 152 (161)
T ss_dssp TCCHHHHHHHHHHHCTTCCCCHHHHHHHHHHHHHHHHHT
T ss_pred CCCHHHHHHHHHHHCCCcCCCHHHHHHHHHHHHHHhcCC
Confidence 999999999999999999999999999999999987653
|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* | Back alignment and structure |
|---|
| >1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A | Back alignment and structure |
|---|
| >3f4a_A Uncharacterized protein YGR203W; protein phosphatase, rhodanese-like family, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.80A {Saccharomyces cerevisiae} PDB: 3fs5_A* | Back alignment and structure |
|---|
| >1vee_A Proline-rich protein family; hypothetical protein, structural genomics, rhodanese domain, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} PDB: 2dcq_A | Back alignment and structure |
|---|
| >3hzu_A Thiosulfate sulfurtransferase SSEA; niaid, ssgcid, infectious disease, transferase structural genomics; 2.10A {Mycobacterium tuberculosis} PDB: 3p3a_A | Back alignment and structure |
|---|
| >1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A | Back alignment and structure |
|---|
| >3flh_A Uncharacterized protein LP_1913; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} PDB: 3fnj_A 3i3u_A | Back alignment and structure |
|---|
| >3g5j_A Putative ATP/GTP binding protein; N-terminal domain of ATP/GTP binding protein, PSI, MCSG, STR genomics, protein structure initiative; HET: PGE; 1.76A {Clostridium difficile} | Back alignment and structure |
|---|
| >3sxu_A DNA polymerase III subunit CHI; DNA replication, CHI binds to SSB and PSI, transferase; HET: DNA; 1.85A {Escherichia coli} SCOP: c.128.1.1 PDB: 1em8_A* | Back alignment and structure |
|---|
| >2jtq_A Phage shock protein E; solution structure rhodanese, stress response, transferase; NMR {Escherichia coli} PDB: 2jtr_A 2jts_A | Back alignment and structure |
|---|
| >2fsx_A RV0390, COG0607: rhodanese-related sulfurtransferase; RV0390 BR SAD DATA with FBAR, structural genomics, PSI; 1.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2hhg_A Hypothetical protein RPA3614; MCSG, structural genomics, rohopseudom palustris, PSI-2, protein structure initiative; 1.20A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3iwh_A Rhodanese-like domain protein; alpha-beta-alpha sandwich, structural genomics, C structural genomics of infectious diseases, csgid; 2.00A {Staphylococcus aureus subsp} PDB: 3mzz_A | Back alignment and structure |
|---|
| >1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3 | Back alignment and structure |
|---|
| >3foj_A Uncharacterized protein; protein SSP1007, structural genomics, PSI-2, protein structure initiative; 1.60A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >1d0q_A DNA primase; zinc-binding motif, protein, transferase; HET: DNA; 1.71A {Geobacillus stearothermophilus} SCOP: g.41.3.2 | Back alignment and structure |
|---|
| >3gk5_A Uncharacterized rhodanese-related protein TVG0868615; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Thermoplasma volcanium GSS1} | Back alignment and structure |
|---|
| >3olh_A MST, 3-mercaptopyruvate sulfurtransferase; structural genomics, structural genomics consortium, SGC, RH fold; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 123 | ||||
| d1m3ga_ | 145 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 2e-28 | |
| d1mkpa_ | 144 | c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapien | 1e-25 | |
| d1vhra_ | 178 | c.45.1.1 (A:) VH1-related dual-specificity phospha | 6e-23 | |
| d1i9sa_ | 194 | c.45.1.1 (A:) mRNA capping enzyme, triphosphatase | 2e-20 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 3e-16 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 6e-12 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 2e-09 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 1e-07 | |
| d1xria_ | 151 | c.45.1.1 (A:) Putative phosphatase At1g05000 {Thal | 2e-04 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 0.004 |
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Mapk phosphatase species: Human (Homo sapiens), pac-1 [TaxId: 9606]
Score = 99.0 bits (246), Expect = 2e-28
Identities = 40/111 (36%), Positives = 63/111 (56%)
Query: 3 GVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHC 62
G+ +LNV+ N F G+F Y +I V D+ ++ + +I KN G +VLVH
Sbjct: 29 GITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVLVHS 88
Query: 63 KMGISRSASVVIAYAMKAYNWDLTRAMAHVRQKRNCIKPNANFITQLETYQ 113
+ GISRSA++ +AY M++ L A V+Q+R I PN +F+ QL ++
Sbjct: 89 QAGISRSATICLAYLMQSRRVRLDEAFDFVKQRRGVISPNFSFMGQLLQFE 139
|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} Length = 144 | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} Length = 178 | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 194 | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 151 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 123 | |||
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 100.0 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 100.0 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 100.0 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 99.94 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 99.93 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 99.93 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.91 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 99.82 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 99.65 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 99.34 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 99.31 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 99.24 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 99.2 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 99.19 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 99.1 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 99.09 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 99.09 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 99.08 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 99.04 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 99.0 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 99.0 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 99.0 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 98.99 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 98.97 | |
| d1ohea1 | 157 | Proline directed phosphatase CDC14b2 {Human (Homo | 97.68 | |
| d1zsqa2 | 387 | Myotubularin-related protein 2, C-terminal domain | 95.56 | |
| d1tq1a_ | 119 | Thiosulfate sulfurtransferase/Senescence-associate | 90.59 | |
| d1yt8a4 | 130 | Thiosulfate sulfurtransferase PA2603 {Pseudomonas | 84.23 | |
| d1urha2 | 120 | 3-mercaptopyruvate sulfurtransferase {Escherichia | 81.49 | |
| d1rhsa2 | 144 | Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | 80.87 | |
| d1gmxa_ | 108 | Sulfurtransferase GlpE {Escherichia coli [TaxId: 5 | 80.22 | |
| d1qxna_ | 137 | Polysulfide-sulfur transferase (sulfide dehydrogen | 80.05 |
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Dual specificity phosphatase-like domain: Mapk phosphatase species: Human (Homo sapiens), pac-1 [TaxId: 9606]
Probab=100.00 E-value=8.1e-38 Score=204.83 Aligned_cols=116 Identities=35% Similarity=0.597 Sum_probs=111.2
Q ss_pred CCCeEEEEcCCCCCCCCCCcceEEEEEeccCCCccHHHHHHHHHHHHHHHHhCCCeEEEEeCCCCchhHHHHHHHHHHHc
Q psy6369 2 DGVCHILNVTREIDNFFPGIFDYCNIRVYDDDKTDLLKHWDNTYKYITSAKNQGSKVLVHCKMGISRSASVVIAYAMKAY 81 (123)
Q Consensus 2 ~gI~~iin~~~~~~~~~~~~i~~~~ipi~d~~~~~~~~~~~~~~~~i~~~~~~~~~vlVHC~~G~~Rs~~~~~ayl~~~~ 81 (123)
+||++|||++.+.+...++.+.|+++|+.|.+..++.+.|+++++||++..++|++|||||.+|+|||+++++||||.+.
T Consensus 28 ~gI~~Iin~~~~~~~~~~~~~~y~~i~i~D~~~~~i~~~~~~~~~~i~~~~~~~~~VlVHC~~G~sRS~~v~~aYLm~~~ 107 (145)
T d1m3ga_ 28 CGITAVLNVSASCPNHFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDWVKNSGGRVLVHSQAGISRSATICLAYLMQSR 107 (145)
T ss_dssp HTCSEEEECSSSSSEEECSSSEEEECCCCCSTTCCCTTSHHHHHHHHHHHHHTTCCEEECCSSSSSHHHHHHHHHHHHTT
T ss_pred cCCcEEEEecCCCCcCCCCceEEEEEeccCCchhhHHHHHHHHHHHHHHhhccCceEEEEcccccccHHHHHHHHHHHHh
Confidence 69999999999988888888999999999998888889999999999999999999999999999999999999999999
Q ss_pred CCCHHHHHHHHHhhCCCCCCCHHHHHHHHHHHhhhc
Q psy6369 82 NWDLTRAMAHVRQKRNCIKPNANFITQLETYQVGVQ 117 (123)
Q Consensus 82 ~~~~~~a~~~v~~~rp~~~~~~~~~~~L~~~~~~l~ 117 (123)
+|++++|+++|+++||.+.||.+|.+||.+||++|-
T Consensus 108 ~~~~~~A~~~v~~~Rp~v~pn~~f~~qL~~~e~~l~ 143 (145)
T d1m3ga_ 108 RVRLDEAFDFVKQRRGVISPNFSFMGQLLQFETQVL 143 (145)
T ss_dssp CCHHHHHHHHHSCSCCCCSSCSSCCCCSHHHHHHHT
T ss_pred CCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHhc
Confidence 999999999999999999999999999999999875
|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea1 c.45.1.1 (A:42-198) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zsqa2 c.45.1.3 (A:199-585) Myotubularin-related protein 2, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tq1a_ c.46.1.3 (A:) Thiosulfate sulfurtransferase/Senescence-associated protein {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yt8a4 c.46.1.2 (A:243-372) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1urha2 c.46.1.2 (A:149-268) 3-mercaptopyruvate sulfurtransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rhsa2 c.46.1.2 (A:150-293) Rhodanese {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1gmxa_ c.46.1.3 (A:) Sulfurtransferase GlpE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qxna_ c.46.1.3 (A:) Polysulfide-sulfur transferase (sulfide dehydrogenase, Sud) {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|