Diaphorina citri psyllid: psy6389


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----
MGLRFSSILSIRNSADGDNMDKHSQDNKSKKNKDKVEDNEPSCSSNDCTDEIGRIMQDKYGGSDQGLNNTPSTSSCKHKKQSRTVRSSKVYSASCSKKKKNNWVLKFSCARSKNNSVDTSPCVCTAYKRVSDSEVNDLPDSTQSRALLPVIDFSKFNPDDYSTEDCDERARIERAREIAEGVDPPPGFRPKHIQIVNLPPELSMDNLTALFQCALTQLETVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQRHYTQPGAVEH
ccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccCCcccccccccccccccccEEEEEcccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHccccccEEEEEccccccccEEEEEEEcccEEEEEEEEcccccccccccccccccccHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccccccc
******************************************************************************************************WVLKFSCA******VDTSPCVCTAYKR*****************LLPVIDFSK*****YSTEDCD***********************KHIQIVNLPPELS**NLTAL*****TQLETVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQRHYTQ******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLRFSSILSIRNSADGDNMDKHSQDNKSKKNKDKVEDNEPSCSSNDCTDEIGRIMQDKYGGSDQGLNNTPSTSSCKHKKQSRTVRSSKVYSASCSKKKKNNWVLKFSCARSKNNSVDTSPCVCTAYKRVSDSEVNDLPDSTQSRALLPVIDFSKFNPDDYSTEDCDERARIERAREIAEGVDPPPGFRPKHIQIVNLPPELSMDNLTALFQCALTQLETVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQRHYTQPGAVEH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Suppressor of cytokine signaling 5 SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Inhibits for instance EGF signaling by mediating the degradation of the EGF receptor/EGFR. Involved in the regulation of T-helper cell differentiation by inhibiting of the IL4 signaling pathway which promotes differentiation into the Th2 phenotype. Can also partially inhibit IL6 and LIF signaling.confidentO75159
Suppressor of cytokine signaling 5 SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Inhibits for instance EGF signaling by mediating the degradation of the EGF receptor/EGFR. Involved in the regulation of T-helper cell differentiation by inhibiting of the IL4 signaling pathway which promotes differentiation into the Th2 phenotype. Can also partially inhibit IL6 and LIF signaling.confidentO54928
Suppressor of cytokine signaling 5 SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Inhibits for instance EGF signaling by mediating the degradation of the EGF receptor/EGFR. Involved in the regulation of T-helper cell differentiation by inhibiting of the IL4 signaling pathway which promotes differentiation into the Th2 phenotype. Can also partially inhibit IL6 and LIF signaling.confidentQ29RN6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045629 [BP]negative regulation of T-helper 2 cell differentiationprobableGO:0050868, GO:0046639, GO:0046637, GO:0046636, GO:0046634, GO:0048583, GO:0050865, GO:0050863, GO:0045580, GO:0045581, GO:0065007, GO:0050789, GO:0051249, GO:0002694, GO:1902105, GO:0045628, GO:0002682, GO:0002683, GO:0045620, GO:0045623, GO:0045622, GO:0050866, GO:0002828, GO:0050793, GO:2000514, GO:2000515, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:0048519, GO:0050794, GO:0051093, GO:0050776, GO:0051250, GO:0002695, GO:1902106, GO:0002697, GO:2000026, GO:0045619, GO:0043371, GO:0043370, GO:0002698, GO:0048523
GO:0045627 [BP]positive regulation of T-helper 1 cell differentiationprobableGO:0050863, GO:0046638, GO:0046637, GO:0046635, GO:0046634, GO:0048583, GO:0002819, GO:0045580, GO:0045582, GO:0050789, GO:0051249, GO:1902105, GO:0050865, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0045622, GO:0045625, GO:0045624, GO:0050793, GO:0002822, GO:0002825, GO:2000516, GO:2000514, GO:0050794, GO:0045597, GO:0045621, GO:0045595, GO:0008150, GO:0050870, GO:0051239, GO:0050867, GO:0050776, GO:0051094, GO:0051251, GO:1902107, GO:0002694, GO:0002697, GO:0002696, GO:2000026, GO:0045619, GO:0043370, GO:0043372, GO:0002699, GO:0048522
GO:0007175 [BP]negative regulation of epidermal growth factor-activated receptor activityprobableGO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0048585, GO:0031324, GO:0048583, GO:0061097, GO:0042059, GO:0042058, GO:0023057, GO:0010563, GO:0010648, GO:0023051, GO:0009892, GO:1901184, GO:1901185, GO:0043086, GO:0051248, GO:0010646, GO:0010605, GO:0009968, GO:0009966, GO:0051348, GO:0051246, GO:0050789, GO:0065007, GO:0044092, GO:0061099, GO:0065009, GO:0010469, GO:0050790, GO:2000272, GO:0006469, GO:0045936, GO:0060255, GO:0031323, GO:0045859, GO:0050794, GO:0051174, GO:0007176, GO:0032268, GO:0008150, GO:0048519, GO:0042325, GO:0032269, GO:0042326, GO:0031399, GO:0050730, GO:0031400, GO:0050732, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0019221 [BP]cytokine-mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0034097, GO:0008150, GO:0071345, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0071310, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0042221, GO:0007154, GO:0070887, GO:0010033, GO:0044699
GO:0007173 [BP]epidermal growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0038127
GO:0032436 [BP]positive regulation of proteasomal ubiquitin-dependent protein catabolic processprobableGO:0009896, GO:0009894, GO:0009893, GO:0032434, GO:0031325, GO:0031323, GO:0042176, GO:0050789, GO:0080090, GO:0031329, GO:0051246, GO:0051247, GO:0008150, GO:0032270, GO:1901800, GO:0048518, GO:0065007, GO:0060255, GO:0031331, GO:0050794, GO:0030162, GO:0019222, GO:0010604, GO:0032268, GO:0045732, GO:0061136, GO:0045862, GO:0048522
GO:0005154 [MF]epidermal growth factor receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515, GO:0070851
GO:0007616 [BP]long-term memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007613, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0048072 [BP]compound eye pigmentationprobableGO:0032502, GO:0048069, GO:0043473, GO:0048066, GO:0008150, GO:0044699
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0046425 [BP]regulation of JAK-STAT cascadeprobableGO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789
GO:0007482 [BP]haltere developmentprobableGO:0032502, GO:0035216, GO:0032501, GO:0044707, GO:0007444, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0044699, GO:0048731, GO:0007275, GO:0048736, GO:0048737
GO:0030718 [BP]germ-line stem cell maintenanceprobableGO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0019827, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0030971 [MF]receptor tyrosine kinase bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0045873 [BP]negative regulation of sevenless signaling pathwayprobableGO:0048856, GO:0022603, GO:0048585, GO:0030154, GO:0048583, GO:0023057, GO:0010648, GO:0023051, GO:0010646, GO:0050789, GO:0044699, GO:0050767, GO:0009968, GO:0009966, GO:0045501, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0010453, GO:0044763, GO:0045676, GO:0046532, GO:0051960, GO:2000026, GO:2000027, GO:0048869, GO:0048731, GO:0048523
GO:0007259 [BP]JAK-STAT cascadeprobableGO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0040008 [BP]regulation of growthprobableGO:0008150, GO:0065007, GO:0050789
GO:0008586 [BP]imaginal disc-derived wing vein morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007476, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0048802 [BP]notum morphogenesisprobableGO:0048563, GO:0048569, GO:0009887, GO:0035220, GO:0009791, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0007477, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0044767, GO:0008150, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731
GO:0045677 [BP]negative regulation of R7 cell differentiationprobableGO:0022603, GO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0051241, GO:0060284, GO:0007275, GO:0045665, GO:0045664, GO:0051960, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763, GO:0045676, GO:0046532, GO:0046533, GO:2000026, GO:2000027, GO:0048731, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IZV, chain A
Confidence level:very confident
Coverage over the Query: 225-387
View the alignment between query and template
View the model in PyMOL