Psyllid ID: psy6389

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-----
MGLRFSSILSIRNSADGDNMDKHSQDNKSKKNKDKVEDNEPSCSSNDCTDEIGRIMQDKYGGSDQGLNNTPSTSSCKHKKQSRTVRSSKVYSASCSKKKKNNWVLKFSCARSKNNSVDTSPCVCTAYKRVSDSEVNDLPDSTQSRALLPVIDFSKFNPDDYSTEDCDERARIERAREIAEGVDPPPGFRPKHIQIVNLPPELSMDNLTALFQCALTQLETVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQRHYTQPGAVEH
cccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccEEEEEcccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHccccccEEEEEccccccccEEEEEEEcccEEEEEEEEcccccccccccccccccccHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccccccc
cccEEcHHEEEEcccccccccccccccHHHcccccccccccccccccccHHHcccHHcccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccEEEEcEEEccccccccccccccccccccEEEHccccccccccccHHHHHHHHHHHHHHcccccccccccccccHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEccHHHHHHHccccccccEEEEEcccccccEEEEEEEccEEEEEEEEEcccEEEEcccccccccccHHHHHHHHccccccccccccEEcccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHccccccEEEccccccc
MGLRFSSILSIrnsadgdnmdkhsqdnkskknkdkvednepscssndctDEIGRImqdkyggsdqglnntpstssckhkkqsrtvrsskvysascskkkknnwVLKFSCArsknnsvdtspcvctaykrvsdsevndlpdstqsrallpvidfskfnpddystedcDERARIERAREiaegvdpppgfrpkhiqivnlppelsmdNLTALFQCALTQLETVVHTSVDYIhclvpdlkditscsfywgKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNhkfsfdshdpnvyasptvcgliehykdptlvmffepmltiplhrnftfplqHICRSVicsnisydgisqlqlPKTLKSYLKEYHYkqrhytqpgaveh
MGLRFSSILSirnsadgdnmdkhsqdnkskknkdkvednepscssndctdEIGRIMQDKYGgsdqglnntpstssckhkkqsrtvrsskvysascskkkknnwvLKFScarsknnsvdtspcVCTAYKRvsdsevndlpdstqsrallpvidfskfnpddysteDCDERARIERAREiaegvdpppgfrpkHIQIVNLPPELSMDNLTALFQCALTQLETVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHkfsfdshdpnVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKqrhytqpgaveh
MGLRFSSILSIRNSADGDNMdkhsqdnkskknkdkVEDNEPSCSSNDCTDEIGRIMQDKYGGSDQGLNNTPSTSSCKHKKQSRTVRSSKVYSASCSKKKKNNWVLKFSCARSKNNSVDTSPCVCTAYKRVSDSEVNDLPDSTQSRALLPVIDFSKFNPDDYSTEDCDerarierareiaeGVDPPPGFRPKHIQIVNLPPELSMDNLTALFQCALTQLETVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQRHYTQPGAVEH
******************************************************************************************************WVLKFSCA******VDTSPCVCTAYKR*****************LLPVIDFSK***********************************KHIQIVNLPPELSMDNLTALFQCALTQLETVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQR**********
****************************************************************************************************************************************************************YSTEDCD****************************************************************LVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQRHYTQ******
MGLRFSSILSIRNSADG****************************NDCTDEIGRIMQDKYGGSDQ********************************KKKNNWVLKFSCARSKNNSVDTSPCVCTAYKRVSDSEVNDLPDSTQSRALLPVIDFSKFNPDDYSTEDCDERARIERAREIAEGVDPPPGFRPKHIQIVNLPPELSMDNLTALFQCALTQLETVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQRHYTQPGAVEH
*GLRFSSILSIRNS*********************************CTDE*G***QDK*****************************************NNWVLKFSCARSKNNSVDTSPCVCTAYKRVS**************ALLPVIDFSKFNPDDYSTEDCDERARIERAREIAEGVDPPPGFRPKHIQIVNLPPELS**NLTAL*****TQLETVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQRHYTQP*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLRFSSILSIRNSADGDNMDKHSQDNKSKKNKDKVEDNEPSCSSNDCTDEIGRIMQDKYGGSDQGLNNTPSTSSCKHKKQSRTVRSSKVYSASCSKKKKNNWVLKFSCARSKNNSVDTSPCVCTAYKRVSDSEVNDLPDSTQSRALLPVIDFSKFNPDDYSTEDCDERARIERAREIAEGVDPPPGFRPKHIQIVNLPPELSMDNLTALFQCALTQLETVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQRHYTQPGAVEH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query395 2.2.26 [Sep-21-2011]
O54928536 Suppressor of cytokine si yes N/A 0.415 0.305 0.707 1e-66
Q29RN6536 Suppressor of cytokine si yes N/A 0.589 0.434 0.510 2e-66
O75159536 Suppressor of cytokine si yes N/A 0.415 0.305 0.707 2e-66
Q0VC91440 Suppressor of cytokine si no N/A 0.432 0.388 0.653 1e-64
Q5RDX2440 Suppressor of cytokine si no N/A 0.432 0.388 0.653 1e-64
Q8WXH5440 Suppressor of cytokine si no N/A 0.432 0.388 0.653 1e-64
Q91ZA6436 Suppressor of cytokine si no N/A 0.432 0.392 0.647 7e-64
Q5RCM6535 Suppressor of cytokine si no N/A 0.387 0.285 0.375 2e-22
O14544535 Suppressor of cytokine si no N/A 0.387 0.285 0.375 3e-22
Q9JLY0533 Suppressor of cytokine si no N/A 0.387 0.287 0.375 4e-22
>sp|O54928|SOCS5_MOUSE Suppressor of cytokine signaling 5 OS=Mus musculus GN=Socs5 PE=1 SV=2 Back     alignment and function desciption
 Score =  253 bits (647), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 116/164 (70%), Positives = 132/164 (80%)

Query: 222 VHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVS 281
           VHT +DYIHCLVPDL  IT    YWG MDRYEAE LLE  PEGTFLLRDSAQE+YLFSVS
Sbjct: 359 VHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVS 418

Query: 282 FRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHR 341
           FR++ RSLHARIEQWNH FSFD+HDP V+ S TV GL+EHYKDP+  MFFEP+LTI L+R
Sbjct: 419 FRRYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNR 478

Query: 342 NFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQR 385
            F F LQ+ICR+VIC   +YDGI  L LP  L+ +LKEYHYKQ+
Sbjct: 479 TFPFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQK 522
SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. May be a substrate-recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Inhibits for instance EGF signaling by mediating the degradation of the EGF receptor/EGFR. Involved in the regulation of T-helper cell differentiation by inhibiting of the IL4 signaling pathway which promotes differentiation into the Th2 phenotype. Can also partially inhibit IL6 and LIF signaling.
Mus musculus (taxid: 10090)
>sp|Q29RN6|SOCS5_BOVIN Suppressor of cytokine signaling 5 OS=Bos taurus GN=SOCS5 PE=2 SV=1 Back     alignment and function description
>sp|O75159|SOCS5_HUMAN Suppressor of cytokine signaling 5 OS=Homo sapiens GN=SOCS5 PE=1 SV=1 Back     alignment and function description
>sp|Q0VC91|SOCS4_BOVIN Suppressor of cytokine signaling 4 OS=Bos taurus GN=SOCS4 PE=2 SV=1 Back     alignment and function description
>sp|Q5RDX2|SOCS4_PONAB Suppressor of cytokine signaling 4 OS=Pongo abelii GN=SOCS4 PE=2 SV=1 Back     alignment and function description
>sp|Q8WXH5|SOCS4_HUMAN Suppressor of cytokine signaling 4 OS=Homo sapiens GN=SOCS4 PE=1 SV=1 Back     alignment and function description
>sp|Q91ZA6|SOCS4_MOUSE Suppressor of cytokine signaling 4 OS=Mus musculus GN=Socs4 PE=2 SV=2 Back     alignment and function description
>sp|Q5RCM6|SOCS6_PONAB Suppressor of cytokine signaling 6 OS=Pongo abelii GN=SOCS6 PE=2 SV=1 Back     alignment and function description
>sp|O14544|SOCS6_HUMAN Suppressor of cytokine signaling 6 OS=Homo sapiens GN=SOCS6 PE=1 SV=2 Back     alignment and function description
>sp|Q9JLY0|SOCS6_MOUSE Suppressor of cytokine signaling 6 OS=Mus musculus GN=Socs6 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
307198828 515 Suppressor of cytokine signaling 5 [Harp 0.734 0.563 0.618 1e-112
383865118 527 PREDICTED: uncharacterized protein LOC10 0.734 0.550 0.609 1e-112
307169858 529 Suppressor of cytokine signaling 5 [Camp 0.734 0.548 0.618 1e-111
332029797 529 Suppressor of cytokine signaling 5 [Acro 0.734 0.548 0.615 1e-111
156544712 527 PREDICTED: hypothetical protein LOC10012 0.734 0.550 0.611 1e-111
242008317 526 suppressors of cytokine signaling-5, put 0.774 0.581 0.545 1e-110
340708864 516 PREDICTED: hypothetical protein LOC10064 0.734 0.562 0.603 1e-110
350419111 516 PREDICTED: hypothetical protein LOC10074 0.726 0.556 0.598 1e-109
328791547 526 PREDICTED: hypothetical protein LOC55203 0.734 0.551 0.600 1e-109
190702400328 cytokine-inducible SH2-like protein [Gly 0.681 0.820 0.614 1e-102
>gi|307198828|gb|EFN79604.1| Suppressor of cytokine signaling 5 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 203/328 (61%), Positives = 244/328 (74%), Gaps = 38/328 (11%)

Query: 96  SKKKKNNWVLKFSCARSKNN-SVDTSP--------CVCTAYKRVSDSEVN-----DLPDS 141
           SKKK++NWVLKF+CA+SKN+ + D  P        CVCT Y+R  +  +      +   +
Sbjct: 163 SKKKRSNWVLKFNCAKSKNSKNTDIIPGQGNSNSDCVCTGYRRTEEHPMGAGIVFNSRSA 222

Query: 142 TQSRAL-----LPVIDFSKFNPDDYSTEDCDERARIERAREIAEGVDPPPGFRPKHIQIV 196
            QS  L      PVID S+FNP+++  EDCDERAR++RARE+ EGV+PPPG+RP +   +
Sbjct: 223 PQSPVLGPLPPSPVIDLSRFNPEEFPMEDCDERARMQRAREMEEGVEPPPGYRPNYPSGI 282

Query: 197 NLPPE-LSMDNLTALFQC-------ALTQLETV-----------VHTSVDYIHCLVPDLK 237
            + P  +++D+L ALFQ        ALT L  +            HT VDY+HCLVPDL+
Sbjct: 283 QVHPNGITVDSLAALFQAHAGIQAAALTALSQIDFTLIPNIERPAHTQVDYVHCLVPDLR 342

Query: 238 DITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWN 297
            IT+CSFYWGKMDRYEAE+LLE   EGTFLLRDSAQEE+LFSVSFRK+GRSLHARIEQWN
Sbjct: 343 SITACSFYWGKMDRYEAERLLEGKQEGTFLLRDSAQEEFLFSVSFRKYGRSLHARIEQWN 402

Query: 298 HKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICS 357
           HKFSFDSHDP VYAS TVCGLIEHYKDP+  MFFEPMLTIPLHRNF FPLQH+CR+VI +
Sbjct: 403 HKFSFDSHDPGVYASETVCGLIEHYKDPSCCMFFEPMLTIPLHRNFAFPLQHLCRAVITT 462

Query: 358 NISYDGISQLQLPKTLKSYLKEYHYKQR 385
             +YDGI++LQLPKTLKSYLKEYHYKQR
Sbjct: 463 RTTYDGINKLQLPKTLKSYLKEYHYKQR 490

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383865118|ref|XP_003708022.1| PREDICTED: uncharacterized protein LOC100882385 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307169858|gb|EFN62367.1| Suppressor of cytokine signaling 5 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332029797|gb|EGI69666.1| Suppressor of cytokine signaling 5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|156544712|ref|XP_001605682.1| PREDICTED: hypothetical protein LOC100122078 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242008317|ref|XP_002424953.1| suppressors of cytokine signaling-5, putative [Pediculus humanus corporis] gi|212508567|gb|EEB12215.1| suppressors of cytokine signaling-5, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340708864|ref|XP_003393038.1| PREDICTED: hypothetical protein LOC100644872 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350419111|ref|XP_003492074.1| PREDICTED: hypothetical protein LOC100743153 [Bombus impatiens] Back     alignment and taxonomy information
>gi|328791547|ref|XP_624419.3| PREDICTED: hypothetical protein LOC552036 [Apis mellifera] Back     alignment and taxonomy information
>gi|190702400|gb|ACE75292.1| cytokine-inducible SH2-like protein [Glyptapanteles flavicoxis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query395
UNIPROTKB|B2WUP1536 SOCS5 "Suppressor of cytokine 0.415 0.305 0.701 4.7e-71
MGI|MGI:2385459536 Socs5 "suppressor of cytokine 0.415 0.305 0.707 1.9e-68
FB|FBgn0041184720 Socs36E "Suppressor of cytokin 0.415 0.227 0.737 4.2e-67
UNIPROTKB|F1MWV6536 SOCS5 "Suppressor of cytokine- 0.415 0.305 0.707 7.7e-66
UNIPROTKB|Q29RN6536 SOCS5 "Suppressor of cytokine 0.415 0.305 0.707 7.7e-66
UNIPROTKB|F1PMW8536 SOCS5 "Uncharacterized protein 0.415 0.305 0.707 7.7e-66
UNIPROTKB|O75159536 SOCS5 "Suppressor of cytokine 0.415 0.305 0.707 7.7e-66
UNIPROTKB|E5F1H9536 SOCS5 "Suppressor of cytokine 0.415 0.305 0.707 7.7e-66
RGD|1564914536 Socs5 "suppressor of cytokine 0.415 0.305 0.707 7.7e-66
ZFIN|ZDB-GENE-080722-18598 socs5b "suppressor of cytokine 0.415 0.274 0.695 2.6e-65
UNIPROTKB|B2WUP1 SOCS5 "Suppressor of cytokine signaling 5" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 632 (227.5 bits), Expect = 4.7e-71, Sum P(3) = 4.7e-71
 Identities = 115/164 (70%), Positives = 132/164 (80%)

Query:   222 VHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVS 281
             VHT +DYIHCLVPDL  IT    YWG MDRYEAE LLE  PEGTFLLRDSAQE+YLFSVS
Sbjct:   359 VHTQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVS 418

Query:   282 FRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHR 341
             FR++ RSLHARIEQWNH FSFD+HDP V+ S TV GL+EHYKDP+  MFFEP+LT+ L+R
Sbjct:   419 FRRYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTVSLNR 478

Query:   342 NFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQR 385
              F F LQ+ICR+VIC   +YDGI  L LP  L+ +LKEYHYKQ+
Sbjct:   479 TFPFSLQYICRAVICRCTTYDGIDDLPLPSMLQDFLKEYHYKQK 522
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0005154 "epidermal growth factor receptor binding" evidence=IEA
GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=IEA
GO:0007175 "negative regulation of epidermal growth factor-activated receptor activity" evidence=IEA
GO:0019221 "cytokine-mediated signaling pathway" evidence=IEA
GO:0030971 "receptor tyrosine kinase binding" evidence=IEA
GO:0032436 "positive regulation of proteasomal ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0045627 "positive regulation of T-helper 1 cell differentiation" evidence=IEA
GO:0045629 "negative regulation of T-helper 2 cell differentiation" evidence=IEA
GO:0016567 "protein ubiquitination" evidence=IEA
MGI|MGI:2385459 Socs5 "suppressor of cytokine signaling 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
FB|FBgn0041184 Socs36E "Suppressor of cytokine signaling at 36E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWV6 SOCS5 "Suppressor of cytokine-signaling 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RN6 SOCS5 "Suppressor of cytokine signaling 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PMW8 SOCS5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O75159 SOCS5 "Suppressor of cytokine signaling 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E5F1H9 SOCS5 "Suppressor of cytokine signaling 5" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1564914 Socs5 "suppressor of cytokine signaling 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080722-18 socs5b "suppressor of cytokine signaling 5b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q29RN6SOCS5_BOVINNo assigned EC number0.51080.58980.4347yesN/A
O54928SOCS5_MOUSENo assigned EC number0.70730.41510.3059yesN/A
O75159SOCS5_HUMANNo assigned EC number0.70730.41510.3059yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
cd10385101 cd10385, SH2_SOCS4, Src homology 2 (SH2) domain fo 2e-47
cd0992381 cd09923, SH2_SOCS_family, Src homology 2 (SH2) dom 1e-40
cd1038681 cd10386, SH2_SOCS5, Src homology 2 (SH2) domain fo 2e-39
cd10388101 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain fo 1e-21
cd10387100 cd10387, SH2_SOCS6, Src homology 2 (SH2) domain fo 4e-20
smart0025284 smart00252, SH2, Src homology 2 domains 1e-16
cd1038298 cd10382, SH2_SOCS1, Src homology 2 (SH2) domain fo 2e-14
cd0373957 cd03739, SOCS_SOCS5, SOCS (suppressors of cytokine 1e-13
cd10383103 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain fo 2e-13
cd0373856 cd03738, SOCS_SOCS4, SOCS (suppressors of cytokine 4e-13
cd0371739 cd03717, SOCS_SOCS_like, SOCS (suppressors of cyto 1e-12
cd0017379 cd00173, SH2, Src homology 2 (SH2) domain 2e-12
cd1071888 cd10718, SH2_CIS, Src homology 2 (SH2) domain foun 9e-11
pfam0001777 pfam00017, SH2, SH2 domain 1e-09
cd10384101 cd10384, SH2_SOCS3, Src homology 2 (SH2) domain fo 2e-09
cd09940102 cd09940, SH2_Vav_family, Src homology 2 (SH2) doma 2e-08
smart0025343 smart00253, SOCS, suppressors of cytokine signalli 6e-08
cd0358741 cd03587, SOCS, SOCS (suppressors of cytokine signa 6e-08
smart0096934 smart00969, SOCS_box, The SOCS box acts as a bridg 2e-07
cd0374149 cd03741, SOCS_SOCS7, SOCS (suppressors of cytokine 2e-07
pfam0752538 pfam07525, SOCS_box, SOCS box 1e-06
cd09942110 cd09942, SH2_nSH2_p85_like, N-terminal Src homolog 2e-06
cd1035592 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma 8e-06
cd1034199 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src 9e-06
cd0993594 cd09935, SH2_ABL, Src homology 2 (SH2) domain foun 1e-05
cd1035291 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 1e-05
cd0993798 cd09937, SH2_csk_like, Src homology 2 (SH2) domain 2e-05
cd0374041 cd03740, SOCS_SOCS6, SOCS (suppressors of cytokine 2e-05
cd1034781 cd10347, SH2_Nterm_shark_like, N-terminal Src homo 2e-05
cd1037096 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domai 4e-05
cd0994195 cd09941, SH2_Grb2_like, Src homology 2 domain foun 5e-05
cd10356113 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domai 5e-05
cd1040998 cd10409, SH2_Nck2, Src homology 2 (SH2) domain fou 8e-05
cd0994598 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 1e-04
cd1040897 cd10408, SH2_Nck1, Src homology 2 (SH2) domain fou 1e-04
cd0994393 cd09943, SH2_Nck_family, Src homology 2 (SH2) doma 2e-04
cd10351103 cd10351, SH2_SH2D4B, Src homology 2 domain found i 3e-04
cd09932104 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src 5e-04
cd09926106 cd09926, SH2_CRK_like, Src homology 2 domain found 0.001
cd09930104 cd09930, SH2_cSH2_p85_like, C-terminal Src homolog 0.002
cd0373641 cd03736, SOCS_SOCS2, SOCS (suppressors of cytokine 0.002
cd1034099 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo 0.003
cd10368101 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain 0.003
cd1035787 cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domai 0.003
cd10367101 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain 0.004
cd10419101 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 0.004
cd1036190 cd10361, SH2_Fps_family, Src homology 2 (SH2) doma 0.004
>gnl|CDD|198248 cd10385, SH2_SOCS4, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information 
 Score =  156 bits (396), Expect = 2e-47
 Identities = 72/101 (71%), Positives = 82/101 (81%)

Query: 233 VPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHAR 292
           VPDL  I +   YWG MD+Y AE LLE  PEGTFLLRDSAQE+YLFSVSFR++ RSLHAR
Sbjct: 1   VPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHAR 60

Query: 293 IEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEP 333
           IEQWNH FSFD+HDP V+ SP + GL+EHYKDP+  MFFEP
Sbjct: 61  IEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEP 101

SH2 domain found in SOCS proteins. SOCS was first recognized as a group of cytokine-inducible SH2 (CIS) domain proteins comprising eight family members in human (CIS and SOCS1-SOCS7). In addition to the SH2 domain, SOCS proteins have a variable N-terminal domain and a conserved SOCS box in the C-terminal domain. SOCS proteins bind to a substrate via their SH2 domain. The prototypical members, CIS and SOCS1-SOCS3, have been shown to regulate growth hormone signaling in vitro and in a classic negative feedback response compete for binding at phosphotyrosine sites in JAK kinase and receptor pathways to displace effector proteins and target bound receptors for proteasomal degradation. Loss of SOCS activity results in excessive cytokine signaling associated with a variety of hematopoietic, autoimmune, and inflammatory diseases and certain cancers. Members (SOCS4-SOCS7) were identified by their conserved SOCS box, an adapter motif of 3 helices that associates substrate binding domains, such as the SOCS SH2 domain, ankryin, and WD40 with ubiquitin ligase components. These show limited cytokine induction. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. Length = 101
>gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family Back     alignment and domain information
>gnl|CDD|198249 cd10386, SH2_SOCS5, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family Back     alignment and domain information
>gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|198250 cd10387, SH2_SOCS6, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information
>gnl|CDD|198245 cd10382, SH2_SOCS1, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|239708 cd03739, SOCS_SOCS5, SOCS (suppressors of cytokine signaling) box of SOCS5-like proteins Back     alignment and domain information
>gnl|CDD|198246 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|239707 cd03738, SOCS_SOCS4, SOCS (suppressors of cytokine signaling) box of SOCS4-like proteins Back     alignment and domain information
>gnl|CDD|239687 cd03717, SOCS_SOCS_like, SOCS (suppressors of cytokine signaling) box of SOCS-like proteins Back     alignment and domain information
>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain Back     alignment and domain information
>gnl|CDD|198285 cd10718, SH2_CIS, Src homology 2 (SH2) domain found in cytokine-inducible SH2-containing protein (CIS) Back     alignment and domain information
>gnl|CDD|215658 pfam00017, SH2, SH2 domain Back     alignment and domain information
>gnl|CDD|198247 cd10384, SH2_SOCS3, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family Back     alignment and domain information
>gnl|CDD|128549 smart00253, SOCS, suppressors of cytokine signalling Back     alignment and domain information
>gnl|CDD|239641 cd03587, SOCS, SOCS (suppressors of cytokine signaling) box Back     alignment and domain information
>gnl|CDD|198037 smart00969, SOCS_box, The SOCS box acts as a bridge between specific substrate- binding domains and more generic proteins that comprise a large family of E3 ubiquitin protein ligases Back     alignment and domain information
>gnl|CDD|239710 cd03741, SOCS_SOCS7, SOCS (suppressors of cytokine signaling) box of SOCS7-like proteins Back     alignment and domain information
>gnl|CDD|219451 pfam07525, SOCS_box, SOCS box Back     alignment and domain information
>gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins Back     alignment and domain information
>gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins Back     alignment and domain information
>gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins Back     alignment and domain information
>gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) Back     alignment and domain information
>gnl|CDD|239709 cd03740, SOCS_SOCS6, SOCS (suppressors of cytokine signaling) box of SOCS6-like proteins Back     alignment and domain information
>gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the Src oncogene at 42A (Src42) Back     alignment and domain information
>gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins Back     alignment and domain information
>gnl|CDD|198219 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases A and C (ShkA and ShkC) Back     alignment and domain information
>gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) Back     alignment and domain information
>gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family Back     alignment and domain information
>gnl|CDD|198214 cd10351, SH2_SH2D4B, Src homology 2 domain found in the SH2 domain containing protein 4B (SH2D4B) Back     alignment and domain information
>gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK Back     alignment and domain information
>gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|239705 cd03736, SOCS_SOCS2, SOCS (suppressors of cytokine signaling) box of SOCS2-like proteins Back     alignment and domain information
>gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn Back     alignment and domain information
>gnl|CDD|198220 cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases D and E (ShkD and ShkE) Back     alignment and domain information
>gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr Back     alignment and domain information
>gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins Back     alignment and domain information
>gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 395
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 99.82
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 99.8
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 99.75
KOG4637|consensus 464 99.7
KOG2996|consensus865 99.65
cd0373957 SOCS_SOCS5 SOCS (suppressors of cytokine signaling 99.64
cd0373856 SOCS_SOCS4 SOCS (suppressors of cytokine signaling 99.64
KOG0790|consensus 600 99.62
KOG4226|consensus379 99.55
KOG4278|consensus 1157 99.53
KOG4792|consensus 293 99.47
KOG1264|consensus 1267 99.47
KOG1264|consensus 1267 99.35
KOG0197|consensus 468 99.31
KOG4566|consensus258 99.3
KOG0194|consensus 474 99.21
cd0373543 SOCS_SOCS1 SOCS (suppressors of cytokine signaling 99.18
cd0374041 SOCS_SOCS6 SOCS (suppressors of cytokine signaling 99.14
cd0373441 SOCS_CIS1 SOCS (suppressors of cytokine signaling) 99.12
cd0374243 SOCS_Rab40 SOCS (suppressors of cytokine signaling 99.07
KOG4637|consensus464 99.05
cd0373641 SOCS_SOCS2 SOCS (suppressors of cytokine signaling 99.04
cd0374149 SOCS_SOCS7 SOCS (suppressors of cytokine signaling 99.03
cd0371739 SOCS_SOCS_like SOCS (suppressors of cytokine signa 98.9
KOG0790|consensus 600 98.84
cd0373742 SOCS_SOCS3 SOCS (suppressors of cytokine signaling 98.82
smart0025343 SOCS suppressors of cytokine signalling. suppresso 98.8
KOG3601|consensus222 98.75
cd0374539 SOCS_WSB2_SWIP2 SOCS (suppressors of cytokine sign 98.72
cd0373339 SOCS_WSB_SWIP SOCS (suppressors of cytokine signal 98.68
cd0374640 SOCS_WSB1_SWIP1 SOCS (suppressors of cytokine sign 98.65
cd0373057 SOCS_ASB14 SOCS (suppressors of cytokine signaling 98.62
PF0752540 SOCS_box: SOCS box; InterPro: IPR001496 The SOCS b 98.55
KOG1930|consensus 483 98.49
cd0358741 SOCS SOCS (suppressors of cytokine signaling) box. 98.43
cd0372544 SOCS_ASB6 SOCS (suppressors of cytokine signaling) 98.4
cd0372251 SOCS_ASB3 SOCS (suppressors of cytokine signaling) 98.33
cd0371642 SOCS_ASB_like SOCS (suppressors of cytokine signal 98.25
cd0371842 SOCS_SSB1_4 SOCS (suppressors of cytokine signalin 98.21
cd0372743 SOCS_ASB8 SOCS (suppressors of cytokine signaling) 98.2
cd0372942 SOCS_ASB13 SOCS (suppressors of cytokine signaling 98.14
cd0372348 SOCS_ASB4_ASB18 SOCS (suppressors of cytokine sign 98.13
cd0372145 SOCS_ASB2 SOCS (suppressors of cytokine signaling) 98.12
cd0372645 SOCS_ASB7 SOCS (suppressors of cytokine signaling) 97.97
cd0373156 SOCS_ASB15 SOCS (suppressors of cytokine signaling 97.94
cd0374342 SOCS_SSB4 SOCS (suppressors of cytokine signaling) 97.92
cd0371942 SOCS_SSB2 SOCS (suppressors of cytokine signaling) 97.89
cd0374442 SOCS_SSB1 SOCS (suppressors of cytokine signaling) 97.78
KOG3751|consensus622 97.7
cd0372042 SOCS_ASB1 SOCS (suppressors of cytokine signaling) 97.66
cd0372842 SOCS_ASB_9_11 SOCS (suppressors of cytokine signal 97.64
cd0372442 SOCS_ASB5 SOCS (suppressors of cytokine signaling) 97.61
KOG3697|consensus345 97.35
PF14633220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 96.87
KOG4566|consensus258 93.07
KOG1856|consensus1299 91.95
PF14633220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 87.78
KOG1856|consensus1299 80.62
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information 
Probab=99.82  E-value=8.2e-20  Score=146.92  Aligned_cols=94  Identities=34%  Similarity=0.492  Sum_probs=80.5

Q ss_pred             CcccccCCHHHHHHHhhcCCCCcEEEecCCCCCceeEEEEeeCCeeeEEEEeeeCceeEEecCCCCCcCCCCHHHHHHHc
Q psy6389         243 SFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHY  322 (395)
Q Consensus       243 pWYHG~ISReEAE~LL~~~pdGTFLVRdSss~~g~FsLSVrt~g~VkH~RI~~~dG~F~L~~~~~~~fsF~SL~ELIeHY  322 (395)
                      +||||.|+|++|+++|.+.++|+||||.|.+.++.|+||++..++++|++|...++.|.+..   ....|+||.+||+||
T Consensus         1 ~w~~g~i~r~~Ae~~L~~~~~G~FLiR~s~~~~~~~~Lsv~~~~~v~H~~I~~~~~~~~~~~---~~~~f~sl~eLv~~y   77 (94)
T cd00173           1 PWYHGPISREEAEELLKKKPDGTFLVRDSESSPGDYVLSVRVKGKVKHYRIERTDDGYYLLG---EGRSFPSLPELIEHY   77 (94)
T ss_pred             CccccCCCHHHHHHHHhcCCCceEEEEecCCCCCCEEEEEEECCEEEEEEEEECCCCeEEec---CCCccCCHHHHHHHH
Confidence            69999999999999999999999999999988999999999999999999998888777764   134689999999999


Q ss_pred             cCCCccccccCcccccc
Q psy6389         323 KDPTLVMFFEPMLTIPL  339 (395)
Q Consensus       323 k~~sl~l~~~~~Lt~PL  339 (395)
                      +.+......+..|+.|+
T Consensus        78 ~~~~~~~~~~~~L~~p~   94 (94)
T cd00173          78 QKNPLSDGLGVKLRYPV   94 (94)
T ss_pred             hhCccCCCcccEeCCcC
Confidence            99874111355677764

SH2 domains typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites.
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>cd03739 SOCS_SOCS5 SOCS (suppressors of cytokine signaling) box of SOCS5-like proteins Back     alignment and domain information
>cd03738 SOCS_SOCS4 SOCS (suppressors of cytokine signaling) box of SOCS4-like proteins Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG4566|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd03735 SOCS_SOCS1 SOCS (suppressors of cytokine signaling) box of SOCS1-like proteins Back     alignment and domain information
>cd03740 SOCS_SOCS6 SOCS (suppressors of cytokine signaling) box of SOCS6-like proteins Back     alignment and domain information
>cd03734 SOCS_CIS1 SOCS (suppressors of cytokine signaling) box of CIS (cytokine-inducible SH2 protein) 1-like proteins Back     alignment and domain information
>cd03742 SOCS_Rab40 SOCS (suppressors of cytokine signaling) box of Rab40-like proteins Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>cd03736 SOCS_SOCS2 SOCS (suppressors of cytokine signaling) box of SOCS2-like proteins Back     alignment and domain information
>cd03741 SOCS_SOCS7 SOCS (suppressors of cytokine signaling) box of SOCS7-like proteins Back     alignment and domain information
>cd03717 SOCS_SOCS_like SOCS (suppressors of cytokine signaling) box of SOCS-like proteins Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>cd03737 SOCS_SOCS3 SOCS (suppressors of cytokine signaling) box of SOCS3-like proteins Back     alignment and domain information
>smart00253 SOCS suppressors of cytokine signalling Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>cd03745 SOCS_WSB2_SWIP2 SOCS (suppressors of cytokine signaling) box of WSB2/SWiP2-like proteins Back     alignment and domain information
>cd03733 SOCS_WSB_SWIP SOCS (suppressors of cytokine signaling) box of WSB/SWiP-like proteins Back     alignment and domain information
>cd03746 SOCS_WSB1_SWIP1 SOCS (suppressors of cytokine signaling) box of WSB1/SWiP1-like proteins Back     alignment and domain information
>cd03730 SOCS_ASB14 SOCS (suppressors of cytokine signaling) box of ASB14-like proteins Back     alignment and domain information
>PF07525 SOCS_box: SOCS box; InterPro: IPR001496 The SOCS box was first identified in SH2-domain-containing proteins of the suppressor of cytokines signalling (SOCS) family [] but was later also found in: the WSB (WD-40-repeat-containing proteins with a SOCS box) family, the SSB (SPRY domain-containing proteins with a SOCS box) family, the ASB (ankyrin-repeat-containing proteins with a SOCS box) family, and ras and ras-like GTPases [] Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>cd03587 SOCS SOCS (suppressors of cytokine signaling) box Back     alignment and domain information
>cd03725 SOCS_ASB6 SOCS (suppressors of cytokine signaling) box of ASB6-like proteins Back     alignment and domain information
>cd03722 SOCS_ASB3 SOCS (suppressors of cytokine signaling) box of ASB3-like proteins Back     alignment and domain information
>cd03716 SOCS_ASB_like SOCS (suppressors of cytokine signaling) box of ASB (ankyrin repeat and SOCS box) and SSB (SPRY domain-containing SOCS box proteins) protein families Back     alignment and domain information
>cd03718 SOCS_SSB1_4 SOCS (suppressors of cytokine signaling) box of SSB1 and SSB4 (SPRY domain-containing SOCS box proteins)-like proteins Back     alignment and domain information
>cd03727 SOCS_ASB8 SOCS (suppressors of cytokine signaling) box of ASB8-like proteins Back     alignment and domain information
>cd03729 SOCS_ASB13 SOCS (suppressors of cytokine signaling) box of ASB13-like proteins Back     alignment and domain information
>cd03723 SOCS_ASB4_ASB18 SOCS (suppressors of cytokine signaling) box of ASB4 and ASB18 proteins Back     alignment and domain information
>cd03721 SOCS_ASB2 SOCS (suppressors of cytokine signaling) box of ASB2-like proteins Back     alignment and domain information
>cd03726 SOCS_ASB7 SOCS (suppressors of cytokine signaling) box of ASB7-like proteins Back     alignment and domain information
>cd03731 SOCS_ASB15 SOCS (suppressors of cytokine signaling) box of ASB15-like proteins Back     alignment and domain information
>cd03743 SOCS_SSB4 SOCS (suppressors of cytokine signaling) box of SSB4 (SPRY domain-containing SOCS box proteins)-like proteins Back     alignment and domain information
>cd03719 SOCS_SSB2 SOCS (suppressors of cytokine signaling) box of SSB2 (SPRY domain-containing SOCS box proteins)-like proteins Back     alignment and domain information
>cd03744 SOCS_SSB1 SOCS (suppressors of cytokine signaling) box of SSB1 (SPRY domain-containing SOCS box proteins)-like proteins Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>cd03720 SOCS_ASB1 SOCS (suppressors of cytokine signaling) box of ASB1-like proteins Back     alignment and domain information
>cd03728 SOCS_ASB_9_11 SOCS (suppressors of cytokine signaling) box of ASB9 and 11 proteins Back     alignment and domain information
>cd03724 SOCS_ASB5 SOCS (suppressors of cytokine signaling) box of ASB5-like proteins Back     alignment and domain information
>KOG3697|consensus Back     alignment and domain information
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information
>KOG4566|consensus Back     alignment and domain information
>KOG1856|consensus Back     alignment and domain information
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information
>KOG1856|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
2izv_A187 Crystal Structure Of Socs-4 In Complex With Elongin 9e-59
2vif_A141 Crystal Structure Of Socs6 Sh2 Domain In Complex Wi 7e-17
2c9w_A169 Crystal Structure Of Socs-2 In Complex With Elongin 1e-13
2hmh_A152 Crystal Structure Of Socs3 In Complex With Gp130(Pt 2e-07
2bbu_A164 Solution Structure Of Mouse Socs3 In Complex With A 8e-07
3hhm_B 373 Crystal Structure Of P110alpha H1047r Mutant In Com 1e-06
2rd0_B 279 Structure Of A Human P110alpha/p85alpha Complex Len 4e-06
2iug_A120 Crystal Structure Of The Pi3-Kinase P85 N-Terminal 1e-05
1fu5_A111 Nmr Structure Of The N-Sh2 Domain Of The P85 Subuni 2e-05
2pna_A104 Structure Of An Sh2 Domain Of The P85 Alpha Subunit 3e-05
1oo3_A111 P395s Mutant Of The P85 Regulatory Subunit Of The N 2e-04
>pdb|2IZV|A Chain A, Crystal Structure Of Socs-4 In Complex With Elongin-B And Elongin-C At 2.55a Resolution Length = 187 Back     alignment and structure 
Iteration: 1

 Score =  224 bits (570), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 103/154 (66%), Positives = 122/154 (79%)
Query: 232 LVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHA 291
           LVPDL  I +   YWG MD+Y AE LLE  PEGTFLLRDSAQE+YLFSVSFR++ RSLHA
Sbjct: 24  LVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHA 83
Query: 292 RIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHIC 351
           RIEQWNH FSFD+HDP V+ SP + GL+EHYKDP+  MFFEP+L+ PL R F F LQHIC
Sbjct: 84  RIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHIC 143
Query: 352 RSVICSNISYDGISQLQLPKTLKSYLKEYHYKQR 385
           R+VIC+  +YDGI  L +P ++K YLKEYHYK +
Sbjct: 144 RTVICNCTTYDGIDALPIPSSMKLYLKEYHYKSK 177
>pdb|2VIF|A Chain A, Crystal Structure Of Socs6 Sh2 Domain In Complex With A C-Kit Phosphopeptide Length = 141 Back     alignment and structure
>pdb|2C9W|A Chain A, Crystal Structure Of Socs-2 In Complex With Elongin-B And Elongin-C At 1.9a Resolution Length = 169 Back     alignment and structure
>pdb|2HMH|A Chain A, Crystal Structure Of Socs3 In Complex With Gp130(Ptyr757) Phosphopeptide Length = 152 Back     alignment and structure
>pdb|2BBU|A Chain A, Solution Structure Of Mouse Socs3 In Complex With A Phosphopeptide From The Gp130 Receptor Length = 164 Back     alignment and structure
>pdb|3HHM|B Chain B, Crystal Structure Of P110alpha H1047r Mutant In Complex With Nish2 Of P85alpha And The Drug Wortmannin Length = 373 Back     alignment and structure
>pdb|2RD0|B Chain B, Structure Of A Human P110alpha/p85alpha Complex Length = 279 Back     alignment and structure
>pdb|2IUG|A Chain A, Crystal Structure Of The Pi3-Kinase P85 N-Terminal Sh2 Domain Length = 120 Back     alignment and structure
>pdb|1FU5|A Chain A, Nmr Structure Of The N-Sh2 Domain Of The P85 Subunit Of Pi3- Kinase Complexed To A Doubly Phosphorylated Peptide Derived From Polyomavirus Middle T Antigen Length = 111 Back     alignment and structure
>pdb|2PNA|A Chain A, Structure Of An Sh2 Domain Of The P85 Alpha Subunit Of Phosphatidylinositol-3-Oh Kinase Length = 104 Back     alignment and structure
>pdb|1OO3|A Chain A, P395s Mutant Of The P85 Regulatory Subunit Of The N- Terminal Src Homology 2 Domain Of Pi3-Kinase Length = 111 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query395
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 3e-71
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 5e-57
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 1e-41
2vif_A141 Suppressor of cytokine signalling 6; growth regula 5e-39
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 9e-38
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 3e-24
3hhm_B 373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 1e-23
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 5e-13
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 5e-17
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 2e-15
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 5e-13
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 6e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-13
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 8e-13
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 1e-12
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 2e-12
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 2e-12
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 5e-12
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 1e-11
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 2e-11
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 4e-11
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 4e-11
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 4e-11
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 6e-11
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 1e-10
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 1e-10
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 2e-10
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 3e-10
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 3e-10
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 4e-10
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 5e-10
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 5e-10
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 6e-10
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 6e-10
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 7e-10
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 8e-10
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 2e-05
2aug_A126 Growth factor receptor-bound protein 14; phosphory 9e-10
2lqn_A 303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 9e-10
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 1e-09
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 1e-09
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 1e-09
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 1e-09
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 3e-07
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 2e-09
2eyz_A 304 V-CRK sarcoma virus CT10 oncogene homolog isoform 2e-09
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 2e-09
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 2e-09
3maz_A125 Signal-transducing adaptor protein 1; modular doma 6e-09
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 6e-09
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 1e-08
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 1e-08
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 1e-08
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 7e-05
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-08
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 3e-08
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 4e-08
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 6e-06
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 7e-08
2dly_A121 FYN-related kinase; BRK family kinase, structural 8e-08
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 8e-08
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 1e-07
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 4e-07
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 5e-07
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 6e-07
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 3e-06
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 3e-06
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 5e-06
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 2e-05
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 8e-05
3qwy_A 308 Cell death abnormality protein 2; cell engulfment, 1e-04
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 1e-04
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 2e-04
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 2e-04
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 4e-04
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 5e-04
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 5e-04
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 Back     alignment and structure
 Score =  220 bits (562), Expect = 3e-71
 Identities = 103/166 (62%), Positives = 126/166 (75%)

Query: 220 TVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFS 279
            +   ++ +   LVPDL  I +   YWG MD+Y AE LLE  PEGTFLLRDSAQE+YLFS
Sbjct: 12  DLGTENLYFQSMLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFS 71

Query: 280 VSFRKFGRSLHARIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPL 339
           VSFR++ RSLHARIEQWNH FSFD+HDP V+ SP + GL+EHYKDP+  MFFEP+L+ PL
Sbjct: 72  VSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPL 131

Query: 340 HRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKEYHYKQR 385
            R F F LQHICR+VIC+  +YDGI  L +P ++K YLKEYHYK +
Sbjct: 132 IRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLKEYHYKSK 177
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 100.0
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 100.0
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 99.9
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 99.9
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 99.9
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 99.89
2dly_A121 FYN-related kinase; BRK family kinase, structural 99.89
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 99.89
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 99.89
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 99.89
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 99.89
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 99.89
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 99.88
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 99.88
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 99.88
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 99.88
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 99.88
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 99.88
2vif_A141 Suppressor of cytokine signalling 6; growth regula 99.88
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 99.88
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 99.88
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 99.87
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 99.87
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.87
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.87
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 99.87
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 99.87
2aug_A126 Growth factor receptor-bound protein 14; phosphory 99.87
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 99.87
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 99.86
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 99.86
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 99.86
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 99.86
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 99.86
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 99.86
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 99.86
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 99.86
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 99.86
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 99.86
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 99.85
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 99.85
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 99.85
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 99.85
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 99.85
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.85
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 99.85
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 99.84
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 99.83
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.83
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.82
3maz_A125 Signal-transducing adaptor protein 1; modular doma 99.82
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 99.81
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 99.8
2eyz_A 304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.79
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 99.79
3hhm_B 373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 99.79
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 99.78
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 99.78
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.77
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.76
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 99.76
2lqn_A 303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.62
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.75
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 99.74
3qwy_A 308 Cell death abnormality protein 2; cell engulfment, 99.71
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.71
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.69
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 99.68
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.68
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 99.67
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 99.65
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 99.62
2shp_A 525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.6
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.6
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.59
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.55
2b3o_A 532 Tyrosine-protein phosphatase, non-receptor type 6; 99.55
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.55
3cxl_A 463 N-chimerin; SH2, RHO-GAP, structural genomics cons 99.54
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.53
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.53
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.51
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 99.41
2jz3_A40 Suppressor of cytokine signaling 3; SOCS proteins, 99.07
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 98.89
1uur_A473 Stata protein, STAT protein; transcription activat 98.03
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 97.73
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 97.63
1y1u_A585 Signal transducer and activator of transcription; 97.21
1yvl_A683 Signal transducer and activator of transcription 1 96.97
1bg1_A596 Protein (transcription factor STAT3B); protein-DNA 96.86
1bf5_A575 Signal transducer and activator of transcription 1 96.55
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 95.75
3bux_B329 E3 ubiquitin-protein ligase CBL; TKB, signal trans 94.27
3op0_A323 Signal transduction protein CBL-C; structural geno 93.85
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 93.41
3psi_A1219 Transcription elongation factor SPT6; nucleus; 3.3 92.29
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
Probab=100.00  E-value=9.4e-45  Score=333.24  Aligned_cols=173  Identities=60%  Similarity=1.065  Sum_probs=152.7

Q ss_pred             cccCCccccccccccCccCCCCCCcccccCCHHHHHHHhhcCCCCcEEEecCCCCCceeEEEEeeCCeeeEEEEeeeCce
Q psy6389         220 TVVHTSVDYIHCLVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHK  299 (395)
Q Consensus       220 ~~vh~qvdyv~~lv~~l~~Le~~pWYHG~ISReEAE~LL~~~pdGTFLVRdSss~~g~FsLSVrt~g~VkH~RI~~~dG~  299 (395)
                      ...+.|++|++++++++..|+.++||||.|+|++||++|.+.++|+||||+|++..+.|+||++..++++||+|...+|.
T Consensus        12 ~~~~~~~~~~~~~v~~~~~l~~~~WYhG~isR~eAE~lL~~~~dGtFLVR~S~~~~~~lsLSvr~~~~v~H~rI~~~~g~   91 (187)
T 2izv_A           12 DLGTENLYFQSMLVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHN   91 (187)
T ss_dssp             -----CCSCEEEECTTHHHHHHCTTEEEECCHHHHHHHHTTCCTTEEEEEECSSTTCSEEEEEEETTEEEEEECEEETTE
T ss_pred             ccCCCccccccccccchhhcccCCccccCCCHHHHHHHhcCCCCCcEEEEECCCCCceEEEEEeeCCeEEEEEEEECCCE
Confidence            34788999999999999999999999999999999999998899999999999888999999999999999999999999


Q ss_pred             eEEecCCCCCcCCCCHHHHHHHccCCCccccccCcccccccccCCCccccccceeeecccccCCccccCCcHHHHHHHHh
Q psy6389         300 FSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNFTFPLQHICRSVICSNISYDGISQLQLPKTLKSYLKE  379 (395)
Q Consensus       300 F~L~~~~~~~fsF~SL~ELIeHYk~~sl~l~~~~~Lt~PL~R~~p~sLQHLCR~tI~~~~~~d~I~~LPLP~~Lk~YL~e  379 (395)
                      |.|+..++....|+||.+||+||+.++.++.+.+.|++||.|..|++||||||++|+++++.+.|+.||||+.|++||++
T Consensus        92 f~l~~~~~~~~~F~SL~eLV~hY~~~~~~~~~~~~L~~Pv~r~~p~sLqhLcR~~i~~~~~~~~i~~LPLP~~Lk~yl~~  171 (187)
T 2izv_A           92 FSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSSMKLYLKE  171 (187)
T ss_dssp             EESCTTCTTSCCBSSHHHHHHHTCCGGGCCTTSCCCCEECCCCSCCCHHHHHHHHHHHHSCHHHHHTSSSCHHHHHHHTS
T ss_pred             EEEeccCCCccccCCHHHHHHHHHhccccccccccccccccccccccHHHHHHHHHHhhcCcCcccccCCCHHHHHHHHh
Confidence            99985433334689999999999999988766789999999988889999999999999988999999999999999999


Q ss_pred             cCCCCcccccCCc
Q psy6389         380 YHYKQRHYTQPGA  392 (395)
Q Consensus       380 YpY~~r~~~~~~~  392 (395)
                      |||+++||||+.|
T Consensus       172 y~y~~~~~~~~~~  184 (187)
T 2izv_A          172 YHYKSKVRVLRID  184 (187)
T ss_dssp             SEEEECCC-----
T ss_pred             CCCcceeeeecCC
Confidence            9999999999986
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>2jz3_A Suppressor of cytokine signaling 3; SOCS proteins, elongins, cytokine signaling, growth regulati phosphoprotein, SH2 domain; NMR {Mus musculus} Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Back     alignment and structure
>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* Back     alignment and structure
>3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 395
d2izva2112 d.93.1.1 (A:274-385) Suppressor of cytokine signal 4e-35
d1xa6a2141 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom 4e-21
d2c9wa2103 d.93.1.1 (A:32-134) Suppressor of cytokine signali 1e-19
d2izva144 a.271.1.1 (A:386-429) Suppressor of cytokine signa 5e-19
d1fu6a_111 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 2e-18
d1mila_104 d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap 7e-18
d1qada_107 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 1e-17
d1r1qa_97 d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA 1e-17
d2c9wa150 a.271.1.1 (A:149-198) Suppressor of cytokine signa 4e-17
d2eyva1109 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo 4e-17
d1jwoa_97 d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho 1e-15
d2shpa2109 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma 2e-15
d1rpya_86 d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor 3e-15
d1jyra_96 d.93.1.1 (A:) Growth factor receptor-bound protein 4e-15
d1i3za_103 d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat 4e-15
d1k9aa2101 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( 8e-15
d1nrva_105 d.93.1.1 (A:) Growth factor receptor-bound protein 1e-14
d1d4ta_104 d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap 2e-14
d2shpa3108 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu 1e-13
d1opka2101 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M 1e-13
d1a81a1129 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom 3e-13
d2qmsa1113 d.93.1.1 (A:420-532) Growth factor receptor-bound 3e-13
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 8e-13
d2cs0a1106 d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai 3e-12
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 7e-12
d1bg1a3141 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) 1e-10
d2oq1a1130 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 2e-10
d1lkka_105 d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo 4e-10
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 4e-10
d2oq1a2124 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 2e-09
d1qcfa2103 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H 2e-09
d1a81a2125 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H 3e-09
d1o48a_106 d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s 8e-09
d1luia_108 d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou 9e-09
d1g83a2104 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H 3e-08
d1blja_114 d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou 4e-08
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: Suppressor of cytokine signaling 4, SOCS-4
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  123 bits (309), Expect = 4e-35
 Identities = 78/112 (69%), Positives = 90/112 (80%)

Query: 232 LVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHA 291
           LVPDL  I +   YWG MD+Y AE LLE  PEGTFLLRDSAQE+YLFSVSFR++ RSLHA
Sbjct: 1   LVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHA 60

Query: 292 RIEQWNHKFSFDSHDPNVYASPTVCGLIEHYKDPTLVMFFEPMLTIPLHRNF 343
           RIEQWNH FSFD+HDP V+ SP + GL+EHYKDP+  MFFEP+L+ PL R F
Sbjct: 61  RIEQWNHNFSFDAHDPCVFHSPDITGLLEHYKDPSACMFFEPLLSTPLIRTF 112
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2izva1 a.271.1.1 (A:386-429) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2c9wa1 a.271.1.1 (A:149-198) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 50 Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query395
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 99.94
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 99.91
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 99.9
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.9
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 99.89
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 99.89
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 99.88
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 99.88
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.88
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.88
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 99.88
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 99.88
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.87
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 99.87
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 99.87
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 99.87
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 99.86
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 99.86
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.86
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 99.86
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.86
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.86
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 99.85
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.85
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 99.85
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 99.85
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 99.85
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.84
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 99.84
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.81
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 99.81
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 99.72
d2izva144 Suppressor of cytokine signaling 4, SOCS-4 {Human 99.59
d2c9wa150 Suppressor of cytokine signaling 2, SOCS-2 {Human 99.49
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 99.44
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 99.37
d1bf5a3142 STAT-1 {Human (Homo sapiens) [TaxId: 9606]} 97.34
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: Suppressor of cytokine signaling 4, SOCS-4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=1.4e-27  Score=199.12  Aligned_cols=111  Identities=69%  Similarity=1.221  Sum_probs=101.6

Q ss_pred             cccCccCCCCCCcccccCCHHHHHHHhhcCCCCcEEEecCCCCCceeEEEEeeCCeeeEEEEeeeCceeEEecCCCCCcC
Q psy6389         232 LVPDLKDITSCSFYWGKMDRYEAEKLLESWPEGTFLLRDSAQEEYLFSVSFRKFGRSLHARIEQWNHKFSFDSHDPNVYA  311 (395)
Q Consensus       232 lv~~l~~Le~~pWYHG~ISReEAE~LL~~~pdGTFLVRdSss~~g~FsLSVrt~g~VkH~RI~~~dG~F~L~~~~~~~fs  311 (395)
                      |++++..|+.++||||.|+|++||++|.+.++|+||||+|++.++.|+||++..++++|++|...+|.|.|+......+.
T Consensus         1 lvp~~~~l~~~~Wy~g~isR~~Ae~lL~~~~~GtFLVR~S~~~~~~~~LSv~~~~~v~H~~I~~~~~~~~l~~~~~~~~~   80 (112)
T d2izva2           1 LVPDLLQINNNPCYWGVMDKYAAEALLEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFH   80 (112)
T ss_dssp             ECTTHHHHHHCTTEEEECCHHHHHHHHTTCCTTEEEEEECSSTTCSEEEEEEETTEEEEEECEEETTEEESCTTCTTSCC
T ss_pred             CCCChHHhccCCCcCCCCCHHHHHHHHccCCCCcEEEeecCCCCCCeEEEEEecCCceEEEEEEeCCeEEEeecccCccc
Confidence            46788889999999999999999999999999999999999999999999999999999999999999999865555567


Q ss_pred             CCCHHHHHHHccCCCccccccCccccccccc
Q psy6389         312 SPTVCGLIEHYKDPTLVMFFEPMLTIPLHRN  342 (395)
Q Consensus       312 F~SL~ELIeHYk~~sl~l~~~~~Lt~PL~R~  342 (395)
                      |+||.+||+||++++.++.+.+.|+.||.|.
T Consensus        81 F~sl~~LV~~Y~~~~~~~~~~~llt~P~~r~  111 (112)
T d2izva2          81 SPDITGLLEHYKDPSACMFFEPLLSTPLIRT  111 (112)
T ss_dssp             BSSHHHHHHHTCCGGGCCTTSCCCCEECCCC
T ss_pred             CCCHHHHHHHHhcccccccCccccCCCCCCC
Confidence            9999999999999998887888999999774
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva1 a.271.1.1 (A:386-429) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wa1 a.271.1.1 (A:149-198) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure