Diaphorina citri psyllid: psy63

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-----
MYACEECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKNAIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQHHRTHKRKDTLENHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVKHLQI
ccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccHHHHHcccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHcccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MYACEECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKNAIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQHHRTHKRKDTLENHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVKHLQI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYACEECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKNAIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQHHRTHKRKDTLENHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVKHLQI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger protein 62 homolog May play a role in differentiating skeletal muscle.confidentQ8NB50

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0034605 [BP]cellular response to heatprobableGO:0009628, GO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0033554, GO:0009266, GO:0009408, GO:0044699
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0071222 [BP]cellular response to lipopolysaccharideprobableGO:0070887, GO:0032496, GO:0044699, GO:0051716, GO:0033993, GO:0009617, GO:0071310, GO:0071219, GO:0071216, GO:0009987, GO:0071396, GO:0008150, GO:0042221, GO:0051707, GO:0010033, GO:0051704, GO:1901700, GO:1901701, GO:0009607, GO:0050896, GO:0002237, GO:0044763
GO:0017053 [CC]transcriptional repressor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KMK, chain A
Confidence level:very confident
Coverage over the Query: 466-517,532-561
View the alignment between query and template
View the model in PyMOL
Template: 2KMK, chain A
Confidence level:very confident
Coverage over the Query: 438-518
View the alignment between query and template
View the model in PyMOL
Template: 2RPC, chain A
Confidence level:very confident
Coverage over the Query: 378-498
View the alignment between query and template
View the model in PyMOL
Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 349-362,381-517
View the alignment between query and template
View the model in PyMOL
Template: 1VD4, chain A
Confidence level:confident
Coverage over the Query: 530-581
View the alignment between query and template
View the model in PyMOL
Template: 1ZW8, chain A
Confidence level:probable
Coverage over the Query: 2-53
View the alignment between query and template
View the model in PyMOL
Template: 3MJH, chain B
Confidence level:probable
Coverage over the Query: 101-127
View the alignment between query and template
View the model in PyMOL
Template: 1A1I, chain A
Confidence level:probable
Coverage over the Query: 100-181
View the alignment between query and template
View the model in PyMOL
Template: 1G2D, chain C
Confidence level:probable
Coverage over the Query: 284-363
View the alignment between query and template
View the model in PyMOL
Template: 2ELU, chain A
Confidence level:probable
Coverage over the Query: 186-211
View the alignment between query and template
View the model in PyMOL
Template: 2K5C, chain A
Confidence level:probable
Coverage over the Query: 73-94
View the alignment between query and template
View the model in PyMOL