Psyllid ID: psy63


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-----
MYACEECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKNAIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQHHRTHKRKDTLENHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVKHLQI
ccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccHHHHHcccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHcccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccEccccHHHHHHHHHcccccccEccccccEEcccccHHEHEHEcccccccccccccEEcccccccEcccccccEccccHHHHHEHccccccccccccccccEccccHHHHHHHHHccccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccEEEcccccccEccccHHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccHHEEEEEcccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHcccccccccccEEccccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccccccEEEccccccccccccccEEEccccHHHHHHHcccccccccccccccEccccccEEccc
myaceecgksfKTKIQLCAHKElvhegkqrsvcdtcgrtyktkhslNQHMKIhsdvrgkknaihvnninkkvsykcpdcsvivvsysgfkshldiHNVEKEYFCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSlnvhsyshtntqfvcsycgntyknpkaltshirnshtihqksiCDVCGKEFRMKRQLKEHMavhttdrpfvcnmcpstfkLKKHLRQHYKVHLKMENHlnrhtnihtgpgyqcnicgrvmndrtnlkVHMRNHTGEKKYICEVCGKGFVQWSSHYYHmfthsesrnfqctvcdkkfatpaglrehkrVHVTNRKNMIDHQRSVhellkpyecdtcghglsskkslddhyrihtgekKYVCQQCGASFTQWASLFYHkfshsetrnqvcsycgktyknpnhlrshlnthtkkRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEfcsagfktkkhlsqhhrthkrkDTLENHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVKHLQI
myaceecgksfktKIQLCAHKelvhegkqrsvcdtCGRTyktkhslnqhmkihsdvrgkknAIHVNNinkkvsykcpDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHIKAVhenvrehqcSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMavhttdrpfvcNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFatpaglrehkrvhvtnrknmidhQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTyknpnhlrshlnthtkkrLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKkhlsqhhrthkrkdtleNHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVKHLQI
MYACEECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKNAIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQHHRTHKRKDTLENHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVKHLQI
*****ECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKNAIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTK*******************MKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSM*****************
MYACEECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKNAIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQHHRTHKRKDTLENHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVKHLQI
********KSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKNAIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKT**************DTLENHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVKHLQI
MYACEECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKNAIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQHHRTHKRKDTLENHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVK****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYACEECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKNAIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSHTNTQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQHHRTHKRKDTLENHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVKHLQI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query585 2.2.26 [Sep-21-2011]
Q8NB50900 Zinc finger protein 62 ho yes N/A 0.929 0.604 0.327 2e-84
P10076861 Zinc finger protein 26 OS no N/A 0.900 0.612 0.314 5e-84
Q8C827914 Zinc finger protein 62 OS no N/A 0.929 0.595 0.322 1e-83
Q9HCG1818 Zinc finger protein 160 O no N/A 0.905 0.647 0.336 2e-83
Q5RDX1737 Zinc finger protein 585A no N/A 0.909 0.721 0.321 2e-82
A6NN141173 Zinc finger protein 729 O no N/A 0.935 0.466 0.324 2e-82
O433451167 Zinc finger protein 208 O no N/A 0.883 0.443 0.332 2e-82
Q52M93769 Zinc finger protein 585B no N/A 0.909 0.691 0.324 3e-82
Q5RB30769 Zinc finger protein 585B no N/A 0.909 0.691 0.318 4e-82
Q6P3V2769 Zinc finger protein 585A no N/A 0.909 0.691 0.319 4e-82
>sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=2 SV=3 Back     alignment and function desciption
 Score =  313 bits (803), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 199/608 (32%), Positives = 288/608 (47%), Gaps = 64/608 (10%)

Query: 2   YACEECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKN 61
           Y C ECGK+F+    L  HK  +H G++   CD CG+T+     L  H +IH+  +    
Sbjct: 253 YECGECGKAFRNSSGLRVHKR-IHTGEKPYECDICGKTFSNSSGLRVHKRIHTGEK---- 307

Query: 62  AIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHI 121
                       Y+C +C    ++     +H  IH  +K Y C  C+K F  +  L+ H 
Sbjct: 308 -----------PYECDECGKAFITCRTLLNHKSIHFGDKPYKCDECEKSFNYSSLLIQH- 355

Query: 122 KAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSH 181
           K +H   + ++C  CGKAF + + + VH RIHTGEK Y C+ CG +F+    L VH   H
Sbjct: 356 KVIHTGEKPYECDECGKAFRNSSGLIVHKRIHTGEKPYKCDVCGKAFSYSSGLAVHKSIH 415

Query: 182 TNTQF-VCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTD 240
              +   C  CG ++     L  H R  HT  +  +CDVCGK FR    LK H  +HT +
Sbjct: 416 PGKKAHECKECGKSFSYNSLLLQH-RTIHTGERPYVCDVCGKTFRNNAGLKVHRRLHTGE 474

Query: 241 RPFVCNMCPSTFKLKKHLRQHYKVHLKMENH--------------LNRHTNIHT-GPGYQ 285
           +P+ C++C   +  +  L+ H  +HL  + +              L +H  IHT    + 
Sbjct: 475 KPYKCDVCGKAYISRSSLKNHKGIHLGEKPYKCSYCEKSFNYSSALEQHKRIHTREKPFG 534

Query: 286 CNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVC 345
           C+ CG+   + + LKVH R HTGE+ Y CE CGK ++  SS   H   H   + F+C  C
Sbjct: 535 CDECGKAFRNNSGLKVHKRIHTGERPYKCEECGKAYISLSSLINHKSVHPGEKPFKCDEC 594

Query: 346 DKKFATPAGLREHKRVHVT-------------NRKNMIDHQRSVHELLKPYECDTCGHGL 392
           +K F T   L  HK+VH+              N  +++   R VH   KPYECD C    
Sbjct: 595 EKAFITYRTLTNHKKVHLGEKPYKCDVCEKSFNYTSLLSQHRRVHTREKPYECDRCEKVF 654

Query: 393 SSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPN 452
            +  SL  H RIHTGE+ Y C  CG ++   +SL  HK +H       C  CGK + +  
Sbjct: 655 RNNSSLKVHKRIHTGERPYECDVCGKAYISHSSLINHKSTHPGRTPHTCDECGKAFFSSR 714

Query: 453 HLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQ 512
            L SH   H  ++ + C  CGK F    LL  H   H   +P++C+ C   F+    L+ 
Sbjct: 715 TLISHKRVHLGEKPFKCVECGKSFSYSSLLSQHKRIHTGEKPYVCDRCGKAFRNSSGLTV 774

Query: 513 HHRTHKRKDTLE---------------NHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMR 557
           H R H  +   E               NH K+VH+  + + C+ C ++F     L  H R
Sbjct: 775 HKRIHTGEKPYECDECGKAYISHSSLINH-KSVHQGKQPYNCE-CGKSFNYRSVLDQHKR 832

Query: 558 IHTGEKKY 565
           IHTG+K Y
Sbjct: 833 IHTGKKPY 840




May play a role in differentiating skeletal muscle.
Homo sapiens (taxid: 9606)
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=2 SV=1 Back     alignment and function description
>sp|Q9HCG1|ZN160_HUMAN Zinc finger protein 160 OS=Homo sapiens GN=ZNF160 PE=2 SV=3 Back     alignment and function description
>sp|Q5RDX1|Z585A_PONAB Zinc finger protein 585A OS=Pongo abelii GN=ZNF585A PE=2 SV=1 Back     alignment and function description
>sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=3 Back     alignment and function description
>sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=1 Back     alignment and function description
>sp|Q52M93|Z585B_HUMAN Zinc finger protein 585B OS=Homo sapiens GN=ZNF585B PE=2 SV=1 Back     alignment and function description
>sp|Q5RB30|Z585B_PONAB Zinc finger protein 585B OS=Pongo abelii GN=ZNF585B PE=2 SV=1 Back     alignment and function description
>sp|Q6P3V2|Z585A_HUMAN Zinc finger protein 585A OS=Homo sapiens GN=ZNF585A PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query585
326667465 2943 PREDICTED: hypothetical protein LOC57172 0.988 0.196 0.351 5e-95
326667299 1069 PREDICTED: zinc finger protein 91-like, 0.958 0.524 0.335 3e-91
326667255 908 PREDICTED: zinc finger protein 91-like [ 0.929 0.599 0.328 7e-91
326666730 1718 PREDICTED: zinc finger protein 729 [Dani 0.929 0.316 0.328 3e-90
440898839 963 hypothetical protein M91_09463, partial 0.955 0.580 0.323 6e-90
326667247 943 PREDICTED: zinc finger protein 850-like 0.969 0.601 0.317 8e-90
326667110 1395 PREDICTED: zinc finger protein 729-like, 0.907 0.380 0.336 5e-89
395505763 1824 PREDICTED: zinc finger protein 91-like [ 0.931 0.298 0.339 5e-89
334349979 731 PREDICTED: zinc finger protein 850-like 0.933 0.746 0.331 7e-89
334328883 1289 PREDICTED: zinc finger protein 850-like 0.931 0.422 0.335 7e-89
>gi|326667465|ref|XP_700431.5| PREDICTED: hypothetical protein LOC571721 [Danio rerio] Back     alignment and taxonomy information
 Score =  355 bits (910), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 225/640 (35%), Positives = 314/640 (49%), Gaps = 62/640 (9%)

Query: 4    CEECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRG----- 58
            C++CGKSF  K  L  H   VH G++   C  CG+++  + +L  HM+IHS V+      
Sbjct: 856  CQQCGKSFIHKQNLKVHMR-VHTGEKPYHCQHCGKSFSQQTNLEGHMRIHSGVKPFTCQE 914

Query: 59   -KKNAIHVNNIN-------KKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKV 110
              K+ +H +N+         +  +KC  C    V     + HL +H  EK + C  C K 
Sbjct: 915  CGKSFVHKHNLQLHLRVHTGEKPFKCQHCGKGFVHKHNLQLHLRVHTGEKPFKCQHCGKG 974

Query: 111  FLRNRNLVCHIKAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFAL 170
            F   +NL  H++ +H   +   C  CGK+F D  N KVHMR+HTGEK Y C+ CG  F+L
Sbjct: 975  FSLQKNLDGHVR-IHTGEKPFSCPQCGKSFIDKQNFKVHMRVHTGEKPYQCQQCGKGFSL 1033

Query: 171  WGSLNVHSYSHTNTQ-FVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQ 229
              SL+ H   HT  + FVC  CG ++     L  H R +HT  +   C  CGK F  K+ 
Sbjct: 1034 KASLDCHMSIHTGLKPFVCQQCGKSFHQRPKLKLH-RRTHTGEKPFTCQHCGKSFAQKQN 1092

Query: 230  LKEHMAVHTTDRPFVCNMCPSTFKLKKHLRQHYKVH--------------LKMENHLNRH 275
            LK HM VHT + P+ C  C  +F  K +L  H  +H                 +  L  H
Sbjct: 1093 LKVHMRVHTRETPYTCQYCGRSFNQKTNLEIHRIIHTGEKPFTCQQCGKSFSQKQTLKVH 1152

Query: 276  TNIHTGP-GYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTH 334
              IHTG   + C+ CG+   D+ NL VHMR HTG+K YIC VCGK F Q  S   H+  H
Sbjct: 1153 MRIHTGEKPFSCHHCGKTFTDKQNLMVHMRIHTGDKPYICTVCGKNFSQKPSLDVHVGIH 1212

Query: 335  SESRNFQCTVCDKKFATPAGLREHKRVH-------------VTNRKNMIDHQRSVHELLK 381
            +  + +QC  C K F     L+ H  +H               NRK  +     +H   K
Sbjct: 1213 TGEKPYQCQQCGKSFNRKQNLQVHMSIHNGDKPYQCQQCGKSFNRKQNLQVHMRIHTGEK 1272

Query: 382  PYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVC 441
            P+ C  CG     K++L  H RIHTGE+ Y CQQCG SFTQ  +L  H   H+  +   C
Sbjct: 1273 PFSCHQCGKTFCQKRNLAIHRRIHTGERPYTCQQCGRSFTQKQNLKVHMRIHTGDKPYQC 1332

Query: 442  SYCGKTYKNPNHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCS 501
              CGK++ +  HL+ H+  HT  + Y C+ C + F + E LK H+  H   +PF C  C 
Sbjct: 1333 QECGKSFIDKQHLKVHMRIHTGDKPYQCQQCERSFDRKENLKVHMRIHTGEKPFTCHQCG 1392

Query: 502  AGFKTKKHLSQHHRTH---------------KRKDTLENHMKAVHEKIRDFQCKVCDRAF 546
                 KK+L  H R H                RK   + HM+ +H K + F C  C R+F
Sbjct: 1393 KSLNRKKNLQVHMRIHTGDKPYQCQQCGKSFNRKQNFQVHMR-IHTKEKPFSCHQCGRSF 1451

Query: 547  FDVYNLKLHMRIHTGEKKYLSMRMSENISAQFAVK-HLQI 585
                NLK+HMR+HTG+K Y   +  ++ S +  +  H++I
Sbjct: 1452 NRKQNLKVHMRVHTGDKPYQCQQCGKSFSQKATLDLHMRI 1491




Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|326667299|ref|XP_002661787.2| PREDICTED: zinc finger protein 91-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|326667255|ref|XP_003198540.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|326666730|ref|XP_003198356.1| PREDICTED: zinc finger protein 729 [Danio rerio] Back     alignment and taxonomy information
>gi|440898839|gb|ELR50255.1| hypothetical protein M91_09463, partial [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|326667247|ref|XP_003198537.1| PREDICTED: zinc finger protein 850-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667110|ref|XP_003198489.1| PREDICTED: zinc finger protein 729-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|395505763|ref|XP_003757207.1| PREDICTED: zinc finger protein 91-like [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|334349979|ref|XP_001381864.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|334328883|ref|XP_001375603.2| PREDICTED: zinc finger protein 850-like [Monodelphis domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query585
ZFIN|ZDB-GENE-110914-160 1003 si:dkey-240n22.7 "si:dkey-240n 0.941 0.549 0.346 7.9e-101
ZFIN|ZDB-GENE-110913-159733 si:ch211-197f20.2 "si:ch211-19 0.941 0.751 0.326 3.7e-96
ZFIN|ZDB-GENE-110913-38 987 si:ch211-208f21.5 "si:ch211-20 0.943 0.559 0.337 3.3e-95
ZFIN|ZDB-GENE-110913-173 819 si:dkey-78k22.1 "si:dkey-78k22 0.941 0.672 0.326 5.3e-95
ZFIN|ZDB-GENE-110913-135689 si:ch211-207e19.14 "si:ch211-2 0.965 0.820 0.321 5.3e-95
ZFIN|ZDB-GENE-110913-157981 si:ch211-245n8.1 "si:ch211-245 0.943 0.562 0.325 2.3e-94
ZFIN|ZDB-GENE-110913-121 898 si:ch211-162i8.3 "si:ch211-162 0.938 0.611 0.325 7.8e-94
ZFIN|ZDB-GENE-071004-105 1014 zgc:173573 "zgc:173573" [Danio 0.905 0.522 0.330 7.8e-94
ZFIN|ZDB-GENE-110913-148 1029 si:dkey-14o6.6 "si:dkey-14o6.6 0.936 0.532 0.324 1.6e-93
UNIPROTKB|H9L0F1900 ZNF555 "Uncharacterized protei 0.928 0.603 0.348 2.7e-93
ZFIN|ZDB-GENE-110914-160 si:dkey-240n22.7 "si:dkey-240n22.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1000 (357.1 bits), Expect = 7.9e-101, P = 7.9e-101
 Identities = 213/615 (34%), Positives = 308/615 (50%)

Query:     2 YACEECGKSFKTKIQLCAHKELVHEGKQRSVCDTCGRTYKTKHSLNQHMKIHSDVRGKKN 61
             Y C++CG+SF  K  L  H+ ++H G++   C  CG+++  K +L  HM+IH+   G+K 
Sbjct:    35 YTCQDCGRSFNQKTNLEIHR-IIHTGEKPFTCQQCGKSFSQKQTLKVHMRIHT---GEK- 89

Query:    62 AIHVNNINKKVSYKCPDCSVIVVSYSGFKSHLDIHNVEKEYFCHICKKVFLRNRNLVCHI 121
                         + C  C            H+ IH  +K Y C +C K F +  +L  H+
Sbjct:    90 -----------PFSCHHCGKTFTDKQNLMVHMRIHTGDKPYICTVCGKNFSQKPSLDVHV 138

Query:   122 KAVHENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVCETCGASFALWGSLNVHSYSH 181
               +H   + +QC  CGK+F    N++VHM IH+G+K Y C+ CG SF    +L VH   H
Sbjct:   139 -GIHTGEKPYQCQQCGKSFNRKQNLQVHMSIHSGDKPYQCQQCGKSFNRKQNLQVHMRIH 197

Query:   182 TNTQ-FVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTD 240
             T  + F C  CG ++   + L  H R  HT  +   C  CGK F  K+ LK HM +HT D
Sbjct:   198 TGEKPFSCHQCGKSFSQKRNLAIH-RRIHTGERPYTCQQCGKSFTQKQNLKVHMRIHTGD 256

Query:   241 RPFVCNMCPSTFKLKKHLRQHYKVHL--------KMENHLNR------HTNIHTGPG-YQ 285
             +P+ C  C  +F  K+HL+ H ++H         +     NR      H  IHT    + 
Sbjct:   257 KPYQCQECGKSFIDKQHLKVHMRIHTGDKPYQCQQCGKSFNRKQNFQVHMRIHTKEKPFS 316

Query:   286 CNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVC 345
             C+ CGR  N + NLKVHMR HTG+K Y C+ CGK F Q ++   HM THS    F C  C
Sbjct:   317 CHQCGRSFNRKQNLKVHMRVHTGDKPYQCQQCGKSFSQKATLDAHMRTHSGLNAFTCQQC 376

Query:   346 DKKFATPAGLREHKRVH--------------VTNRKNMIDHQRSVHELLKPYECDTCGHG 391
              K F     L+ H R+H               + + ++  H+R VH   KPY C  CG  
Sbjct:   377 GKSFGQKQKLQLHMRIHSREKPYKCQHCGESFSQKAHLTGHER-VHTKEKPYTCLQCGKC 435

Query:   392 LSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNP 451
              S K++L  H RIH+GEK Y CQ CG SF Q + L  H   H+  +   C  CGK++   
Sbjct:   436 FSLKQNLKLHVRIHSGEKPYQCQHCGKSFNQRSHLTGHTRIHTGEKPFSCQQCGKSFAQQ 495

Query:   452 NHLRSHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLS 511
              +L+ H+  HT++R Y C+ CGK F   + LK H+  H   +P++C+ C   F  K +L 
Sbjct:   496 TNLKVHMRVHTRERPYTCQDCGKRFFHKQNLKVHMRVHTGEKPYVCQQCGKSFSQKTNLD 555

Query:   512 QHHRTHKRKDTLENHMKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHTGEKKYLSMRMS 571
              H  TH                +  F C+ C ++F    NLK+HMR+HTGEK Y   +  
Sbjct:   556 AHMGTHS--------------VVNPFICQQCGKSFGHKQNLKIHMRVHTGEKPYSCGQCG 601

Query:   572 ENISAQFAVK-HLQI 585
             ++     ++K H++I
Sbjct:   602 KSFRQYPSLKIHVRI 616


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-110913-159 si:ch211-197f20.2 "si:ch211-197f20.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-38 si:ch211-208f21.5 "si:ch211-208f21.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-173 si:dkey-78k22.1 "si:dkey-78k22.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-135 si:ch211-207e19.14 "si:ch211-207e19.14" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-157 si:ch211-245n8.1 "si:ch211-245n8.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-121 si:ch211-162i8.3 "si:ch211-162i8.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-105 zgc:173573 "zgc:173573" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-148 si:dkey-14o6.6 "si:dkey-14o6.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0F1 ZNF555 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8NB50ZFP62_HUMANNo assigned EC number0.32730.92990.6044yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query585
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 4e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
 Score = 45.8 bits (108), Expect = 4e-05
 Identities = 68/454 (14%), Positives = 127/454 (27%), Gaps = 59/454 (12%)

Query: 126 ENVREHQCSVCGKAFADITNMKVHMRIHTGEKKYVC--ETCGASFALWGSLNVHSYSHTN 183
              R   C  C  +F+ + ++  H+R HTGEK   C    C  SF+    L+ H  +H N
Sbjct: 29  NAPRPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHN 88

Query: 184 -TQFVCSYCGNTYKNPKALTSHIRNSHTIHQKSICDVCGKEFRMKRQLKEHMAVHTTDRP 242
               + S       +  + +S   +S   +  ++                     ++  P
Sbjct: 89  NPSDLNSKSLPLSNSKASSSSLSSSSSNSNDNNLLSSHSL-------------PPSSRDP 135

Query: 243 FVCNMCPSTFKLKKHLRQHYKVHLKMENHLNRHTNIHTGPGYQCNICGRVMNDRTNLKVH 302
            + ++   +      L  +    +      + H  +        ++     ++ + L   
Sbjct: 136 QLPDLLSISNLRNNPLPGNNSSSVNTPQSNSLHPPLP-----ANSLSKDPSSNLSLLISS 190

Query: 303 MRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVH 362
             + +             +   SS       +S S             T + L     + 
Sbjct: 191 NVSTSIPSSSENSPLSSSYSIPSSSSDQNLENSSSSL--------PLTTNSQLSPKSLLS 242

Query: 363 VTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTG-EKKYVCQQCGASFT 421
            +          S     +            S    +       G       +QC  SF+
Sbjct: 243 QSPSSLSSSD--SSSSASESPRSSLPTASSQSSSPNESDSSSEKGFSLPIKSKQCNISFS 300

Query: 422 QWASLFYHK------FSHSETRNQVCSYCGKTYKNPNHLRSHLNTHTKKRLYVC--ETCG 473
           + + L  H           +  +   S CGK +   + L+ H+  HT             
Sbjct: 301 RSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSS 360

Query: 474 KEFMKLELLKSHLTTH-----LAARPFICE--FCSAGFKTKKHLSQHHRTHKRKDTLENH 526
            +F  L   +   +          +        C   FK   +LS H  TH         
Sbjct: 361 SKFSPLLNNEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCK 420

Query: 527 MKAVHEKIRDFQCKVCDRAFFDVYNLKLHMRIHT 560
                          C ++F   YNL  H +IHT
Sbjct: 421 ------------NPPCSKSFNRHYNLIPHKKIHT 442


Length = 467

>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 585
KOG1074|consensus958 99.96
KOG1074|consensus958 99.96
KOG2462|consensus279 99.95
KOG3608|consensus467 99.95
KOG2462|consensus279 99.95
KOG3608|consensus467 99.94
KOG3623|consensus 1007 99.91
KOG3623|consensus 1007 99.91
KOG3576|consensus267 99.75
KOG3576|consensus267 99.69
PLN03086567 PRLI-interacting factor K; Provisional 99.27
PLN03086567 PRLI-interacting factor K; Provisional 99.18
PHA00733128 hypothetical protein 99.14
PHA00733128 hypothetical protein 99.12
PHA0276855 hypothetical protein; Provisional 98.98
PHA0276855 hypothetical protein; Provisional 98.94
KOG1146|consensus1406 98.91
KOG3993|consensus500 98.8
KOG3993|consensus500 98.76
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.75
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.7
PHA0061644 hypothetical protein 98.61
PHA0061644 hypothetical protein 98.47
KOG1146|consensus 1406 98.42
PHA0073279 hypothetical protein 98.35
PHA0073279 hypothetical protein 98.29
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.26
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.1
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.92
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.76
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.63
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.54
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.52
COG5189423 SFP1 Putative transcriptional repressor regulating 97.5
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.38
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.38
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.35
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.31
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.02
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.99
smart0035526 ZnF_C2H2 zinc finger. 96.92
COG5189423 SFP1 Putative transcriptional repressor regulating 96.9
KOG2231|consensus 669 96.82
smart0035526 ZnF_C2H2 zinc finger. 96.59
PRK04860160 hypothetical protein; Provisional 96.54
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.41
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.37
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.31
PRK04860160 hypothetical protein; Provisional 96.24
KOG2231|consensus669 96.02
KOG2482|consensus423 95.88
COG5236493 Uncharacterized conserved protein, contains RING Z 95.76
KOG2785|consensus390 95.76
KOG2785|consensus390 95.65
COG5048467 FOG: Zn-finger [General function prediction only] 95.64
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.57
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.48
KOG2482|consensus423 95.15
COG5236493 Uncharacterized conserved protein, contains RING Z 94.83
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 94.25
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 94.11
COG5048467 FOG: Zn-finger [General function prediction only] 93.51
KOG2893|consensus 341 93.5
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.49
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.07
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 91.49
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.46
KOG4173|consensus253 90.8
KOG2893|consensus341 90.58
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 90.14
KOG4173|consensus253 88.77
COG404965 Uncharacterized protein containing archaeal-type C 88.2
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 87.65
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 86.34
COG404965 Uncharacterized protein containing archaeal-type C 85.18
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 82.77
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 81.39
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 81.2
>KOG1074|consensus Back     alignment and domain information
Probab=99.96  E-value=2.7e-31  Score=260.10  Aligned_cols=236  Identities=27%  Similarity=0.536  Sum_probs=175.2

Q ss_pred             CCCCCchhhhccCchhHHHHHhhcCCCCccccccccccccCcccHHHHhhhcCCC----CCcccc---cCCcccCChHHH
Q psy63           283 GYQCNICGRVMNDRTNLKVHMRNHTGEKKYICEVCGKGFVQWSSHYYHMFTHSES----RNFQCT---VCDKKFATPAGL  355 (585)
Q Consensus       283 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~----~~~~C~---~C~~~f~~~~~l  355 (585)
                      +-+|-+|-++..=.+.|+.|.+.|+|++||+|.+||+.|.++.+|+.||-+|...    ..+.|+   +|-+.|.....|
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            4689999999999999999999999999999999999999999999999998654    358899   999999999999


Q ss_pred             HhhhhhhcccccchhhhhhhhccCCCCccCCCccccCCChhhHHHHHhhccC----------------CC----CccCCc
Q psy63           356 REHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTG----------------EK----KYVCQQ  415 (585)
Q Consensus       356 ~~H~~~h~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~----------------~~----~~~C~~  415 (585)
                      ..|+++|......-..-.  .......-+|..|.+.|.....+..++..|.+                +.    +..+..
T Consensus       685 pQhIriH~~~~~s~g~~a--~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~  762 (958)
T KOG1074|consen  685 PQHIRIHLGGQISNGGTA--AEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENS  762 (958)
T ss_pred             cceEEeecCCCCCCCccc--ccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCccccc
Confidence            999999874321110000  01122335799999999888888888766622                22    466778


Q ss_pred             cccccCChHHHHhhhh-----------------------hcCCCCcc-ccCccCCccCCchhhh----hH--------h-
Q psy63           416 CGASFTQWASLFYHKF-----------------------SHSETRNQ-VCSYCGKTYKNPNHLR----SH--------L-  458 (585)
Q Consensus       416 C~~~f~~~~~l~~H~~-----------------------~h~~~~~~-~C~~C~~~f~~~~~l~----~H--------~-  458 (585)
                      |+..+.....+..+-.                       ..+++++. .+.+++......-...    .-        . 
T Consensus       763 ~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~  842 (958)
T KOG1074|consen  763 CGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLA  842 (958)
T ss_pred             cccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcccccccccccc
Confidence            8888766555443321                       12344455 5666664432211110    00        0 


Q ss_pred             -----hhcCC------------------------CCcccccccccccCChhhHHHHHhhccCCCCccCcccccccCCchh
Q psy63           459 -----NTHTK------------------------KRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKH  509 (585)
Q Consensus       459 -----~~h~~------------------------~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~  509 (585)
                           .++.+                        .....|.+|++.|.+.++|..|+++|++++||.|.+|++.|+++.+
T Consensus       843 t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgn  922 (958)
T KOG1074|consen  843 TKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGN  922 (958)
T ss_pred             cccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhh
Confidence                 00000                        0127899999999999999999999999999999999999999999


Q ss_pred             hhhhhhhccCc
Q psy63           510 LSQHHRTHKRK  520 (585)
Q Consensus       510 l~~H~~~h~~~  520 (585)
                      |+.||.+|...
T Consensus       923 LKvHMgtH~w~  933 (958)
T KOG1074|consen  923 LKVHMGTHMWV  933 (958)
T ss_pred             hhhhhcccccc
Confidence            99999998753



>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query585
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 9e-30
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-28
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-13
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-11
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 3e-06
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 7e-11
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 5e-09
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 4e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 9e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 4e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-10
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 8e-05
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-10
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-08
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-05
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-05
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 8e-10
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-07
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-09
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 3e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-09
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-07
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-05
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-09
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-05
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-09
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 2e-08
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-07
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 5e-09
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-07
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-08
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 3e-07
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 9e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 3e-05
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-08
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 8e-08
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 6e-06
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 7e-04
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-08
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 5e-08
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-08
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 9e-08
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-07
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-05
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-08
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 6e-08
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 4e-07
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 7e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-08
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 8e-08
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-07
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-05
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 4e-08
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-08
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 6e-08
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-07
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 7e-08
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 7e-08
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 6e-07
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 2e-05
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-07
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-05
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-07
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 2e-06
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 4e-07
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 4e-06
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 8e-07
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 1e-06
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-06
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 3e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 5e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 5e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 6e-05
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 6e-06
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 1e-05
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 6e-05
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 6e-06
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-05
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-05
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 8e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 7e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 1e-04
2dlk_A79 Solution Structure Of The First And The Second Zf-C 2e-04
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 4e-04
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 5e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 128 bits (321), Expect = 9e-30, Method: Compositional matrix adjust. Identities = 69/185 (37%), Positives = 93/185 (50%), Gaps = 15/185 (8%) Query: 338 RNFQCTVCDKKFATPAGLREHKRVHVTNRKNMIDHQRSVHELLKPYECDTCGHGLSSKKS 397 + + C C K F+ L EH+R H KPY+C CG S KK Sbjct: 20 KPYACPECGKSFSRSDHLAEHQRTHTGE---------------KPYKCPECGKSFSDKKD 64 Query: 398 LDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLRSH 457 L H R HTGEK Y C +CG SF+Q A+L H+ +H+ + C CGK++ HLR+H Sbjct: 65 LTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAH 124 Query: 458 LNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQHHRTH 517 THT ++ Y C CGK F + + L +H TH +P+ C C F + L+ H RTH Sbjct: 125 QRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTH 184 Query: 518 KRKDT 522 K T Sbjct: 185 TGKKT 189
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query585
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-37
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-36
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-35
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-31
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-30
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-25
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-22
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-18
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-27
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-26
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-24
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-22
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-16
1tf6_A190 Protein (transcription factor IIIA); complex (tran 9e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-24
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-23
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-16
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-13
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-23
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-21
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-18
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 6e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-15
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 8e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-19
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-15
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-13
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-12
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-21
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-20
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-18
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-18
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-17
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-16
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-15
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-14
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-21
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-20
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-18
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-17
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-19
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-18
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-16
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-13
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-19
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-14
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-13
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-10
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-19
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-18
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-17
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-16
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-16
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-15
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-15
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-11
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-18
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-17
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-14
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-13
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-12
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-15
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-14
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-12
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-11
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-17
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-07
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-17
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-16
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-15
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-14
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-13
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-12
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-12
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-11
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-16
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-14
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-14
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-10
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-15
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-12
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-11
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-10
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-13
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-12
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-11
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-11
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-14
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 9e-12
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 9e-11
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-14
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-10
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-10
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-10
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-11
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-10
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-10
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-13
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-12
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-09
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-13
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-12
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 9e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-09
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-10
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 9e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 9e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-10
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 7e-08
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-06
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 7e-08
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 8e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 8e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 8e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-06
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 6e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 9e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 8e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 8e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 5e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 8e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 9e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 8e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 9e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 6e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 9e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 7e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 4e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 3e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 6e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 9e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  136 bits (344), Expect = 2e-37
 Identities = 67/214 (31%), Positives = 89/214 (41%), Gaps = 32/214 (14%)

Query: 251 TFKLKKHLRQHYKVHLKMENHLNRHTNIHTG--PGYQCNICGRVMNDRTNLKVHMRNHTG 308
           +                          +  G  P Y C  CG+  +   +L  H R HTG
Sbjct: 2   SEFGSSSSVAQAA--------------LEPGEKP-YACPECGKSFSRSDHLAEHQRTHTG 46

Query: 309 EKKYICEVCGKGFVQWSSHYYHMFTHSESRNFQCTVCDKKFATPAGLREHKRVHVTNRKN 368
           EK Y C  CGK F        H  TH+  + ++C  C K F+  A LR H+R H T    
Sbjct: 47  EKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTH-TGE-- 103

Query: 369 MIDHQRSVHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFY 428
                       KPY C  CG   S    L  H R HTGEK Y C +CG SF++  +L  
Sbjct: 104 ------------KPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHT 151

Query: 429 HKFSHSETRNQVCSYCGKTYKNPNHLRSHLNTHT 462
           H+ +H+  +   C  CGK++   + L  H  THT
Sbjct: 152 HQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHT 185


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query585
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.9
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.9
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.9
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.9
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.81
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.81
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.8
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.79
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.79
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.79
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.78
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.77
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.76
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.76
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.75
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.74
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.74
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.72
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.7
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.7
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.7
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.7
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.69
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.68
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.65
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.63
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.62
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.62
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.62
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.61
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.6
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.59
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.59
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.59
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.58
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.57
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.57
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.55
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.55
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.54
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.53
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.53
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.52
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.52
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.52
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.51
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.5
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.5
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.49
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.49
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.47
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.47
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.47
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.46
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.44
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.44
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.41
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.4
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.4
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.38
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.37
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.37
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.37
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.32
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.31
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.28
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.28
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.28
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.28
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.27
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.27
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.27
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.27
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.26
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.26
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.26
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.25
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.24
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.23
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.22
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.22
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.21
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.21
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.2
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.19
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.17
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.15
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.14
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.13
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.11
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.11
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.11
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.1
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.09
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.03
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.02
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.02
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.01
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.01
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.01
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.01
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.01
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.99
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.99
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.98
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.98
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.97
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.95
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.95
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.94
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.92
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.91
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.91
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.91
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.9
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.89
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.88
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.88
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.86
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.82
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.79
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.76
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.73
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.73
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.72
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.7
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.7
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.69
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.62
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.62
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.61
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.61
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.58
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.55
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.54
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.51
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.49
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.45
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.42
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.41
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.38
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.37
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.37
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.36
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.35
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.34
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.31
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.3
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.29
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.29
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.29
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.28
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.61
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.26
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.25
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.25
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.57
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.23
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.21
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.19
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.19
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.15
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.14
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.13
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.12
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.11
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.09
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.09
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.35
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.06
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.06
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.05
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.05
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.05
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.3
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.03
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.25
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.99
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.16
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.9
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.88
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.64
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.46
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.3
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.79
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.38
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.25
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.02
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.86
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.85
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.72
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.59
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.46
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.21
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.28
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 86.14
2k5c_A95 Uncharacterized protein PF0385; structural genomic 85.85
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 85.74
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 85.28
2k5c_A95 Uncharacterized protein PF0385; structural genomic 83.58
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 82.81
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 80.76
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=3.9e-39  Score=287.12  Aligned_cols=176  Identities=36%  Similarity=0.757  Sum_probs=147.4

Q ss_pred             hccCCCCccCCCccccCCChhhHHHHHhhccCCCCccCCccccccCChHHHHhhhhhcCCCCccccCccCCccCCchhhh
Q psy63           376 VHELLKPYECDTCGHGLSSKKSLDDHYRIHTGEKKYVCQQCGASFTQWASLFYHKFSHSETRNQVCSYCGKTYKNPNHLR  455 (585)
Q Consensus       376 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  455 (585)
                      .+.++++|.|+.|++.|.+...|..|++.|.++++|.|++|++.|.+...|..|++.|.++++|.|++|++.|.+...|.
T Consensus        15 ~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~   94 (190)
T 2i13_A           15 LEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLR   94 (190)
T ss_dssp             ----------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHH
T ss_pred             hcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHH
Confidence            34556799999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHhhhcCCCCcccccccccccCChhhHHHHHhhccCCCCccCcccccccCCchhhhhhhhhccCchhhhhhhhhhhcCCC
Q psy63           456 SHLNTHTKKRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQHHRTHKRKDTLENHMKAVHEKIR  535 (585)
Q Consensus       456 ~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~l~~~~~~~~~~~~  535 (585)
                      .|+++|+++++|.|++|++.|.+...|..|+++|++++||.|++|++.|.++..|..|+++|              .+++
T Consensus        95 ~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H--------------~~~~  160 (190)
T 2i13_A           95 AHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTH--------------TGEK  160 (190)
T ss_dssp             HHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHH--------------HCCC
T ss_pred             HHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhc--------------CCCC
Confidence            99999999999999999999999999999999999999999999999999999999999865              4568


Q ss_pred             ccccccccccccChhhHHHHHhhhcCCCcc
Q psy63           536 DFQCKVCDRAFFDVYNLKLHMRIHTGEKKY  565 (585)
Q Consensus       536 ~~~C~~C~~~f~~~~~l~~H~~~h~~~k~~  565 (585)
                      ||+|++|+++|.+..+|..|+++|+|++||
T Consensus       161 ~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          161 PYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             CEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             CeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            999999999999999999999999999997



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 585
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 6e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.003
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.003
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-05
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 9e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.003
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 9e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.004
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 4e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.003
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 7e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 7e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.001
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.003
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.003
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.002
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.002
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 0.004
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-04
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.7 bits (101), Expect = 1e-06
 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 1/33 (3%)

Query: 131 HQCSVCGKAFADITNMKVHMR-IHTGEKKYVCE 162
           + C  CGK F+   ++  H++ +HT E+ + C+
Sbjct: 6   YICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQ 38


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query585
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.66
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.57
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.26
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.24
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.19
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.18
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.17
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.15
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.15
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.15
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.12
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.12
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.11
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.1
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.07
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.06
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.06
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.01
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.0
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.98
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.98
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.97
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.95
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.91
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.89
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.88
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.86
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.86
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.72
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.72
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.69
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.61
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.61
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.6
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.51
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.49
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.46
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.43
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.39
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.32
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.26
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.24
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.24
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.2
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.99
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.94
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.91
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.91
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.85
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.81
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.79
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.76
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.74
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.74
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.63
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.56
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.55
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.54
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.46
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.46
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.41
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.38
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.37
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.35
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.26
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.22
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.2
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.2
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.14
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.13
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.06
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.03
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.91
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.84
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.81
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.8
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.78
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.62
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.62
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.6
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.52
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.42
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.3
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.25
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.01
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.94
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.87
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.73
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.69
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.68
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.61
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.34
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.24
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 94.03
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.7
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.39
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.27
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.24
d1y0jb136 U-shaped transcription factor, different fingers { 90.63
d1y0jb136 U-shaped transcription factor, different fingers { 90.07
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.97
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 89.68
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.61
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 89.5
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.43
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.36
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 88.76
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.65
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 87.29
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.22
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 85.04
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 84.63
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 84.61
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 84.51
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 84.09
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 84.08
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 82.69
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 82.23
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 81.19
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66  E-value=2.2e-17  Score=108.44  Aligned_cols=53  Identities=40%  Similarity=0.860  Sum_probs=48.1

Q ss_pred             CCcccccccccccCChhhHHHHHhhccCCCCccCcccccccCCchhhhhhhhhc
Q psy63           464 KRLYVCETCGKEFMKLELLKSHLTTHLAARPFICEFCSAGFKTKKHLSQHHRTH  517 (585)
Q Consensus       464 ~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h  517 (585)
                      |+||.|+ ||+.|.....|..|+++|+|++||.|++||++|.+.+.|..||++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            5789995 9999999999999999999999999999999999999999999876



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure