Diaphorina citri psyllid: psy6410


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MPTTQVEQTITYGPYENVPPYTKANITIHYENNSPFLVVTRLVRQIEVSHWGTLNIESFTSVMPTTQVEQTITYGPYENVPPYTKANITIHYENNSPFLVVTRLVRQIEVSHWEHIHLKHDGAKLKGTFSRYDYQRDSAHGIKSFKTILPAAASDAYYRDEIGKRFIYS
ccccEEEEEEEEECccccccccccCEEEEEEccccCEccEEEEEEEEEEEcccccccccccccccCECccEEEEcccccccccccccEEEEEEcccccEEEEEEEEEEEEEEEEEEEEEECccccccccccEECccccccccEEEEEEcccccccEEEEcccccEEEcc
****QVEQTITYGPYENVPPYTKANITIHYENNSPFLVVTRLVRQIEVSHWGTLNIESFTSVMPTTQVEQTITYGPYENVPPYTKANITIHYENNSPFLVVTRLVRQIEVSHWEHIHLKHDGAKLKGTFSRYDYQRDSAHGIKSFKTILPAAASDAYYRDEIGKRFIY*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPTTQVEQTITYGPYENVPPYTKANITIHYENNSPFLVVTRLVRQIEVSHWGTLNIESFTSVMPTTQVEQTITYGPYENVPPYTKANITIHYENNSPFLVVTRLVRQIEVSHWEHIHLKHDGAKLKGTFSRYDYQRDSAHGIKSFKTILPAAASDAYYRDEIGKRFIYS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 Essential subunit of N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.confidentQ5RFB6
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 Essential subunit of N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.confidentQ91YQ5
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 Essential subunit of N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains.confidentP07153

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted