Diaphorina citri psyllid: psy6442

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-

MCVDGKPMLRQGDTGDWIGTFEGHKGCVWGVDINKDASKAASGAADFQAKNNTRLISCAEDKTVRLWDVSASAEVQKLEFGAVPNSLEISRDGTTITVTHGSCVTFLDANSLELIKEHKVPAQVHSASLLLNSERPIFVCGGEDLKMYKFDYSTGAEIESFKGHFGPIHCVKFSPDGELYASGSEDGTLRLWQTNVGKTYGLWKCIEGGLNNSLGLDSSGHLNNVHEVIAN

ccccccEEEEEcccccEEEEcccccccEEEEEEcccccEEEEcccccccccccEEEEccccccEEEEEcccccEEEEccccccEEEEEEcccccEEEEEccccEEEEEcccccEEEEECcccCEEEEEEECcccccEEEEEcccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEccccccEEEEEcccccEEEEEcccccccEEEEEEccccccccEEEEEcc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Serine-threonine kinase receptor-associated protein	The SMN complex plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus. STRAP may play a role in the cellular distribution of the SMN complex.	confident	Q54LT8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005102 [MF]	receptor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0000122 [BP]	negative regulation of transcription from RNA polymerase II promoter	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030054 [CC]	cell junction	probable	GO:0005575
GO:0030512 [BP]	negative regulation of transforming growth factor beta receptor signaling pathway	probable	GO:0090287, GO:0009968, GO:0090101, GO:0009966, GO:0048583, GO:0048585, GO:0017015, GO:0090288, GO:0050794, GO:0090092, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VYH, chain C
Confidence level:very confident
Coverage over the Query: 1-219
View the alignment between query and template
View the model in PyMOL