Diaphorina citri psyllid: psy6446


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130----
MGTVWDAVSGEELHSFQHPHIVKSSVHFATDSYRLATGSNDKNIRIYDLNKPDAEPTVYRGHSSGIKHVQFFKNNTRLISCAEDKTVRLWDVSASAEVQKLEFGAVPNSLEISRDGTTITVTHGSCVTFLDANS
cCEEEEcccccEEEEcccccccEEEEEEcccccEEEEcccccEEEEEEcccccccccccccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEccccccEEEEEEcccccEEEEEccccEEEEEccc
MGTVWDAVSGEELHSFQHPHIVKSSVHFATDSYRLATGSNDKNIRIYDLNKPDAEPTVYRGHSSGIKHVQFFKNNTRLISCAEDKTVRLWDVSASAEVQKLEFGAVPNSLEISRDGTTITVTHGSCVTFLDANS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTVWDAVSGEELHSFQHPHIVKSSVHFATDSYRLATGSNDKNIRIYDLNKPDAEPTVYRGHSSGIKHVQFFKNNTRLISCAEDKTVRLWDVSASAEVQKLEFGAVPNSLEISRDGTTITVTHGSCVTFLDANS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0019222 [BP]regulation of metabolic processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0044451 [CC]nucleoplasm partprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DM0, chain A
Confidence level:very confident
Coverage over the Query: 1-134
View the alignment between query and template
View the model in PyMOL