Diaphorina citri psyllid: psy6450


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MNLIPPLITLHDLTQKAHRLLPTNLFVVLYNFKSRHADELDLKPGYKVTVIDTSDQNWWKGKCMGRVGYFPSNYVIKVQPGERPLQVTHNLQIADGESGLSLLRDQIVIQIGDEVDGMVMIRNGENRQGVCPLKYLQEV
ccccccccccccccccccccccccEEEEEEEcccccccccccccccEEEEEEcccccccEEEEccEEEEEccccEEEccccccccEEEEcccccccccccccccccEEEEEccccccEEEEEccccCEEEECcccEECc
***IPPL**L****QKAHRLLPTNLFVVLYNFKSRHADELDLKPGYKVTVIDTSDQNWWKGKCMGRVGYFPSNYVIKVQPGERPLQVTHNLQIADGESGLSLLRDQIVIQIGDEVDGMVMIRNGENRQGVCPLKYLQEV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNLIPPLITLHDLTQKAHRLLPTNLFVVLYNFKSRHADELDLKPGYKVTVIDTSDQNWWKGKCMGRVGYFPSNYVIKVQPGERPLQVTHNLQIADGESGLSLLRDQIVIQIGDEVDGMVMIRNGENRQGVCPLKYLQEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0012506 [CC]vesicle membraneprobableGO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0031988, GO:0005575, GO:0012505, GO:0043227, GO:0043226, GO:0044422, GO:0031982
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3QWY, chain A
Confidence level:very confident
Coverage over the Query: 23-76
View the alignment between query and template
View the model in PyMOL