Diaphorina citri psyllid: psy6453

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--

MVLQRIIQISDLMKMKNLCPLRDSPDNGTPEDNTDFGPDENEEPVPTQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRHLGPHPRLHRKDHRLFRALVSGICPLVVLSLRGSSIDDCMTGGPRLALSIIPGLTSLTSKYPQYHPRGSSIDDCMTGGPRLALSIIPGLTSKYPQYHPRFDK

cHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEECcccccccccccccccEEEEEEcccccccHHHHHHcccccccccccccccccEEEECccccEEEEccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

*****IIQI***********************************************QLEA***TTI****PKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRHLGPHPRLHRKDHRLFRALVSGICPLVVLSLRGSSIDDCMTGGPRLALSIIPGLTSLTSKYPQYHPRGSSIDDCMTGGPRLALSIIPGLT************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016023 [CC]	cytoplasmic membrane-bounded vesicle	probable	GO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0016567 [BP]	protein ubiquitination	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VK6, chain A
Confidence level:very confident
Coverage over the Query: 95-199
View the alignment between query and template
View the model in PyMOL