Psyllid ID: psy6453

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MVLQRIIQISDLMKMKNLCPLRDSPDNGTPEDNTDFGPDENEEPVPTQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRHLGPHPRLHRKDHRLFRALVSGICPLVVLSLRGSSIDDCMTGGPRLALSIIPGLTSLTSKYPQYHPRGSSIDDCMTGGPRLALSIIPGLTSKYPQYHPRFDK
cHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccccccccccccEEEEEEcccccccHHHHHHcccccccccccccccccEEEEEccccEEEEccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccEEEccccHHHcccccEEEcccccccccHEEccccEEEEEEccccccEEEEcccccccEEEEEEEccccEEEEHHHHHHcccccccccccccEEEEEEcccccEEEEcccccccccccccccEccHHHHHHHHHcccccccHccccHHHHHHHHcccccEEEEEEcccccccccccccHHHHEEcccccccccccccccccccccccccccccHHHEEEccccccccccccccccc
MVLQRIIQISDLMkmknlcplrdspdngtpedntdfgpdeneepvptqidmeadisqleaptfttitrgppkpmlslrwDHTVHLIGekvlnpiihtcekcekpimiygrmipcrhvfclscaqaprspptclrcgegvtrveptglgtvfmcthggarhstagckrTYLSQRDLMALGrhlgphprlhrkdHRLFRALVSGICPLVVLSLrgssiddcmtggprlalsiipgltsltskypqyhprgssiddcmtggprlalsiipgltskypqyhprfdk
MVLQRIIQISDLMKMKNLCPLRDSPDNGTPEDNTDFGPDENEEPVPTQIDMEADISQLEaptfttitrgppkPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRHLGPHPRLHRKDHRLFRALVSGICPLVVLSLRGSSIDDCMTGGPRLALSIIPGLTSLTSKYPQYHPRGSSIDDCMTGGPRLALsiipgltskypqyhprfdk
MVLQRIIQISDLMKMKNLCPLRDSPDNGTPEDNTDFGPDENEEPVPTQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRHLGPHPRLHRKDHRLFRALVSGICPLVVLSLRGSSIDDCMTGGPRLALSIIPGLTSLTSKYPQYHPRGSSIDDCMTGGPRLALSIIPGLTSKYPQYHPRFDK
*****IIQI******************************************************TTI******PMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRHLGPHPRLHRKDHRLFRALVSGICPLVVLSLRGSSIDDCMTGGPRLALSIIPGLTSLTSKYPQYHPRGSSIDDCMTGGPRLALSIIPGLT************
********************************************************QLEA**********PKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRH*****************************************************************************************************
MVLQRIIQISDLMKMKNLCPLRDSPDNGTPEDNTDFGPDENEEPVPTQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRHLGPHPRLHRKDHRLFRALVSGICPLVVLSLRGSSIDDCMTGGPRLALSIIPGLTSLTSKYPQYHPRGSSIDDCMTGGPRLALSIIPGLTSKYPQYHPRFDK
MVLQRIIQISDLMKMKNLCPLR*********************PVPTQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRHLGPHPRLHRKDHRLFRALVSGICPLVVLSLRGSSIDDCMTGGPRLALSIIPGLTSLTSKYPQYHPRGSSIDDCMTGGPRLALSIIPGLTSKYPQYHPRF**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLQRIIQISDLMKMKNLCPLRDSPDNGTPEDNTDFGPDENEEPVPTQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRHLGPHPRLHRKDHRLFRALVSGICPLVVLSLRGSSIDDCMTGGPRLALSIIPGLTSLTSKYPQYHPRGSSIDDCMTGGPRLALSIIPGLTSKYPQYHPRFDK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query282 2.2.26 [Sep-21-2011]
Q5ZHZ4 493 E3 ubiquitin-protein liga yes N/A 0.340 0.194 0.476 2e-19
Q75N03 491 E3 ubiquitin-protein liga yes N/A 0.425 0.244 0.410 3e-19
Q4R7I8 490 E3 ubiquitin-protein liga N/A N/A 0.425 0.244 0.410 3e-19
Q9JIY2 491 E3 ubiquitin-protein liga yes N/A 0.425 0.244 0.402 4e-19
Q4V7X9 496 E3 ubiquitin-protein liga N/A N/A 0.347 0.197 0.429 5e-18
Q4R361 422 E3 ubiquitin-protein liga N/A N/A 0.326 0.218 0.470 8e-17
Q8N7E2 425 E3 ubiquitin-protein liga no N/A 0.351 0.232 0.449 1e-15
>sp|Q5ZHZ4|HAKAI_CHICK E3 ubiquitin-protein ligase Hakai OS=Gallus gallus GN=CBLL1 PE=2 SV=1 Back     alignment and function desciption
 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 63/105 (60%), Gaps = 9/105 (8%)

Query: 79  WDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCA--QAPRSPPTCLRCG 136
           WD+ ++L+GEK   P+ H C+KC  PI +YGRMIPC+HVFC  CA     +    C  C 
Sbjct: 91  WDYKINLLGEKDDTPV-HFCDKCGLPIKMYGRMIPCKHVFCYDCAILHEKKGDKMCPGCN 149

Query: 137 EGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRH 181
           E V R+E    G++FMC+         GCKRTYLSQRDL A   H
Sbjct: 150 EPVQRIEQCVRGSLFMCS------IVQGCKRTYLSQRDLQAHINH 188
Promotes ubiquitination of tyrosine-phosphorylated CDH1, thus targeting CDH1 for endocytosis and degradation.
Gallus gallus (taxid: 9031)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q75N03|HAKAI_HUMAN E3 ubiquitin-protein ligase Hakai OS=Homo sapiens GN=CBLL1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R7I8|HAKAI_MACFA E3 ubiquitin-protein ligase Hakai OS=Macaca fascicularis GN=CBLL1 PE=2 SV=1 Back     alignment and function description
>sp|Q9JIY2|HAKAI_MOUSE E3 ubiquitin-protein ligase Hakai OS=Mus musculus GN=Cbll1 PE=1 SV=1 Back     alignment and function description
>sp|Q4V7X9|HAKAI_XENLA E3 ubiquitin-protein ligase Hakai OS=Xenopus laevis GN=cbll1 PE=2 SV=1 Back     alignment and function description
>sp|Q4R361|ZN645_MACFA E3 ubiquitin-protein ligase ZNF645 OS=Macaca fascicularis GN=ZNF645 PE=2 SV=1 Back     alignment and function description
>sp|Q8N7E2|ZN645_HUMAN E3 ubiquitin-protein ligase ZNF645 OS=Homo sapiens GN=ZNF645 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
307179314 415 E3 ubiquitin-protein ligase Hakai [Campo 0.588 0.4 0.618 2e-54
383851562 427 PREDICTED: E3 ubiquitin-protein ligase H 0.563 0.372 0.654 4e-54
380029147 429 PREDICTED: uncharacterized protein LOC10 0.535 0.351 0.670 7e-54
307203524 444 E3 ubiquitin-protein ligase Hakai [Harpe 0.503 0.319 0.693 9e-54
340722230 428 PREDICTED: hypothetical protein LOC10064 0.507 0.334 0.703 1e-53
350396283 407 PREDICTED: hypothetical protein LOC10074 0.507 0.351 0.703 1e-53
322794151 422 hypothetical protein SINV_12098 [Solenop 0.556 0.372 0.637 2e-53
345479656 491 PREDICTED: hypothetical protein LOC10011 0.468 0.268 0.746 6e-53
195115278292 GI17246 [Drosophila mojavensis] gi|19391 0.507 0.489 0.664 1e-51
170060921323 conserved hypothetical protein [Culex qu 0.553 0.482 0.610 4e-51
>gi|307179314|gb|EFN67678.1| E3 ubiquitin-protein ligase Hakai [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 112/181 (61%), Positives = 126/181 (69%), Gaps = 15/181 (8%)

Query: 14  KMKNLCPLRDSPDNGTPEDNTDF------GPDENEEPVPTQ-------IDMEADISQLEA 60
           K K    + +S D  TP+   D       G  E  EP  TQ        D+EADISQLEA
Sbjct: 28  KSKKQVKVIESDDEDTPQQTDDTPAETVGGEQEEHEPPATQQPSLEQQFDLEADISQLEA 87

Query: 61  PTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCL 120
           PTFTTI RGPP+PML LRWDH V+LIGEKVLNP+IH C+KC KPI+IYGRMIPC+HVFCL
Sbjct: 88  PTFTTINRGPPEPMLRLRWDHRVNLIGEKVLNPMIHCCDKCLKPILIYGRMIPCKHVFCL 147

Query: 121 SCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGR 180
           SCA+  R    C RC E V+RVE TGLGTVFMCTHGG R+  AGC+RTYLSQRDL A   
Sbjct: 148 SCAK--REDKVCPRCMEKVSRVEQTGLGTVFMCTHGGTRYGNAGCRRTYLSQRDLQAHIN 205

Query: 181 H 181
           H
Sbjct: 206 H 206

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383851562|ref|XP_003701301.1| PREDICTED: E3 ubiquitin-protein ligase Hakai-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380029147|ref|XP_003698243.1| PREDICTED: uncharacterized protein LOC100864501 [Apis florea] Back     alignment and taxonomy information
>gi|307203524|gb|EFN82557.1| E3 ubiquitin-protein ligase Hakai [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340722230|ref|XP_003399511.1| PREDICTED: hypothetical protein LOC100649743 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350396283|ref|XP_003484499.1| PREDICTED: hypothetical protein LOC100743484 [Bombus impatiens] Back     alignment and taxonomy information
>gi|322794151|gb|EFZ17360.1| hypothetical protein SINV_12098 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|345479656|ref|XP_001600401.2| PREDICTED: hypothetical protein LOC100115770 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|195115278|ref|XP_002002191.1| GI17246 [Drosophila mojavensis] gi|193912766|gb|EDW11633.1| GI17246 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|170060921|ref|XP_001866016.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167879253|gb|EDS42636.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query282
FB|FBgn0032812452 Hakai "Hakai" [Drosophila mela 0.503 0.314 0.671 9.2e-52
UNIPROTKB|C9J121282 CBLL1 "E3 ubiquitin-protein li 0.347 0.347 0.467 8e-21
UNIPROTKB|C9J2P9323 CBLL1 "E3 ubiquitin-protein li 0.347 0.303 0.467 8e-21
UNIPROTKB|Q5ZHZ4 493 CBLL1 "E3 ubiquitin-protein li 0.340 0.194 0.476 1.8e-20
RGD|1310703 416 Cbll1 "Cbl proto-oncogene, E3 0.347 0.235 0.457 2.6e-20
UNIPROTKB|B7ZM03 490 CBLL1 "CBLL1 protein" [Homo sa 0.347 0.2 0.467 3.8e-20
UNIPROTKB|I3LM23 490 CBLL1 "Uncharacterized protein 0.347 0.2 0.467 3.8e-20
UNIPROTKB|Q4R7I8 490 CBLL1 "E3 ubiquitin-protein li 0.347 0.2 0.467 3.8e-20
UNIPROTKB|J9NV88 491 CBLL1 "Uncharacterized protein 0.347 0.199 0.467 3.8e-20
UNIPROTKB|Q75N03 491 CBLL1 "E3 ubiquitin-protein li 0.347 0.199 0.467 3.8e-20
FB|FBgn0032812 Hakai "Hakai" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 537 (194.1 bits), Expect = 9.2e-52, P = 9.2e-52
 Identities = 98/146 (67%), Positives = 121/146 (82%)

Query:    44 PVPTQ-IDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCE 102
             PV +Q IDMEADISQLEAPTFTT++RGPP+PML L+W+H V LIGEKVLNP+IH C++C+
Sbjct:   116 PVMSQTIDMEADISQLEAPTFTTLSRGPPEPMLRLKWNHKVSLIGEKVLNPMIHCCDQCD 175

Query:   103 KPIMIYGRMIPCRHVFCLSCAQAPRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHST 162
             KPI++YGRMIPC+HVFCL CA+A     +C RC + V RVE +GLGTVFMCTHGG+R+ +
Sbjct:   176 KPILVYGRMIPCKHVFCLKCARA-EPIKSCPRCTDKVLRVEQSGLGTVFMCTHGGSRYGS 234

Query:   163 AGCKRTYLSQRDLMAL--GRHLGPHP 186
             +GC+RTYLSQRDL A    RH+ P P
Sbjct:   235 SGCRRTYLSQRDLQAHINHRHVAPQP 260
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0007427 "epithelial cell migration, open tracheal system" evidence=IMP
GO:0007391 "dorsal closure" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0008258 "head involution" evidence=IMP
GO:0040003 "chitin-based cuticle development" evidence=IMP
GO:0045296 "cadherin binding" evidence=IPI
GO:0016023 "cytoplasmic membrane-bounded vesicle" evidence=IDA
GO:0060429 "epithelium development" evidence=IMP
GO:0007015 "actin filament organization" evidence=IMP
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0035282 "segmentation" evidence=IMP
GO:0007494 "midgut development" evidence=IMP
UNIPROTKB|C9J121 CBLL1 "E3 ubiquitin-protein ligase Hakai" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9J2P9 CBLL1 "E3 ubiquitin-protein ligase Hakai" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZHZ4 CBLL1 "E3 ubiquitin-protein ligase Hakai" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1310703 Cbll1 "Cbl proto-oncogene, E3 ubiquitin protein ligase-like 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B7ZM03 CBLL1 "CBLL1 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LM23 CBLL1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R7I8 CBLL1 "E3 ubiquitin-protein ligase Hakai" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|J9NV88 CBLL1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q75N03 CBLL1 "E3 ubiquitin-protein ligase Hakai" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 282
KOG2932|consensus 389 100.0
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 97.46
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 97.29
cd0016245 RING RING-finger (Really Interesting New Gene) dom 97.14
KOG2879|consensus298 96.96
PHA02929238 N1R/p28-like protein; Provisional 96.82
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 96.8
PF1463444 zf-RING_5: zinc-RING finger domain 96.24
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 96.03
KOG2164|consensus 513 96.01
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 95.71
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 95.29
smart0050463 Ubox Modified RING finger domain. Modified RING fi 95.08
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 94.53
PHA02926242 zinc finger-like protein; Provisional 93.63
KOG0978|consensus698 93.63
KOG0320|consensus187 93.25
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 93.1
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 92.87
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 92.84
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 92.6
KOG0824|consensus 324 92.53
KOG4739|consensus233 91.71
COG5189423 SFP1 Putative transcriptional repressor regulating 91.58
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 91.46
KOG0317|consensus293 91.26
KOG2177|consensus 386 90.61
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 90.05
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 88.45
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 87.42
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 86.64
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 86.21
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 85.18
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 84.36
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 83.27
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 83.06
PRK14559 645 putative protein serine/threonine phosphatase; Pro 82.88
PF04641260 Rtf2: Rtf2 RING-finger 82.81
KOG1039|consensus344 82.73
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 81.36
>KOG2932|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.1e-61  Score=451.70  Aligned_cols=165  Identities=39%  Similarity=0.674  Sum_probs=149.4

Q ss_pred             cccccccccccccCCceeecccCCCCCcceeeccceeeeecccccCCcceecccCCCceEEEEeecccccccccccccCC
Q psy6453          47 TQIDMEADISQLEAPTFTTITRGPPKPMLSLRWDHTVHLIGEKVLNPIIHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAP  126 (282)
Q Consensus        47 ~~~d~eadisqleap~ftt~~r~Ppe~mlrl~wd~kVnLIGEK~~np~iHFCdkCdlPI~IYGRmIPCKHVFCy~CA~l~  126 (282)
                      ..+|||+||+++|+|+|++|+|+|+    +|+|+++|+++|||++++++||||+|||||+||||||||||||||+||+++
T Consensus        46 ~tv~~e~~~~~~~~p~f~~~~r~pp----hl~w~~~V~~~gek~l~p~VHfCd~Cd~PI~IYGRmIPCkHvFCl~CAr~~  121 (389)
T KOG2932|consen   46 VTVACEDHLVLADLPVFKGIGRVPP----HLTWIKPVGRRGEKQLGPRVHFCDRCDFPIAIYGRMIPCKHVFCLECARSD  121 (389)
T ss_pred             eeeccchhhhhcCCchhcccccCCC----ceeeeeecccccccccCcceEeecccCCcceeeecccccchhhhhhhhhcC
Confidence            4899999999999999999999999    999999999999999999999999999999999999999999999999997


Q ss_pred             CCCCccCCCccceeeeeEecCCcEEEcccCCccccCccccccccChHhHHHHhhccCCCCCcccccccchhhhhcccCCc
Q psy6453         127 RSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQRDLMALGRHLGPHPRLHRKDHRLFRALVSGICPL  206 (282)
Q Consensus       127 k~~k~CprC~d~V~rIEq~~lgsVFMCt~gg~r~~v~gCkRTYLSQRDLQAHInH~h~~p~~~~~~~~~~~a~~~~~~p~  206 (282)
                       ++|+|++|+|+|+||||+.+|+||||+.      ++||+|||||||||||||||+|.     +..+.++++ ++|.-|-
T Consensus       122 -~dK~Cp~C~d~VqrIeq~~~g~iFmC~~------~~GC~RTyLsqrDlqAHInhrH~-----~~~~p~~~~-e~~~pp~  188 (389)
T KOG2932|consen  122 -SDKICPLCDDRVQRIEQIMMGGIFMCAA------PHGCLRTYLSQRDLQAHINHRHG-----SLLQPDAEK-EDGNPPD  188 (389)
T ss_pred             -ccccCcCcccHHHHHHHhcccceEEeec------chhHHHHHhhHHHHHHHhhhhhc-----cccCCchhh-hcCCCCC
Confidence             6999999999999999999999999996      99999999999999999999994     333333333 3344555


Q ss_pred             eEecCCCCCCCccccCCcccee
Q psy6453         207 VVLSLRGSSIDDCMTGGPRLAL  228 (282)
Q Consensus       207 v~~~~~~ss~~~~~~~~p~~~l  228 (282)
                      +...+.+|+++.+..+.|.+.+
T Consensus       189 ~qp~~q~s~~~e~p~~~~l~s~  210 (389)
T KOG2932|consen  189 VQPTMQQSSASESPLRAPLRSQ  210 (389)
T ss_pred             CCCccccchhhcCCcccchhcc
Confidence            6777889999999888887766

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PRK14559 putative protein serine/threonine phosphatase; Provisional Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3vk6_A101 Crystal Structure Of A Phosphotyrosine Binding Doma 8e-16
>pdb|3VK6|A Chain A, Crystal Structure Of A Phosphotyrosine Binding Domain Length = 101 Back     alignment and structure 
Iteration: 1

 Score = 80.9 bits (198), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 52/89 (58%), Gaps = 8/89 (8%)
Query: 95  IHTCEKCEKPIMIYGRMIPCRHVFCLSCA--QAPRSPPTCLRCGEGVTRVEPTGLGTVFM 152
           +H C+KC  PI +YGRMIPC+HVFC  CA     +    C  C + V R+E    G++FM
Sbjct: 1   VHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFM 60
Query: 153 CTHGGARHSTAGCKRTYLSQRDLMALGRH 181
           C+         GCKRTYLSQRDL A   H
Sbjct: 61  CS------IVQGCKRTYLSQRDLQAHINH 83

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query282
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 1e-24
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-04
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Length = 101 Back     alignment and structure
 Score = 94.1 bits (233), Expect = 1e-24
 Identities = 45/102 (44%), Positives = 56/102 (54%), Gaps = 10/102 (9%)

Query: 95  IHTCEKCEKPIMIYGRMIPCRHVFCLSCAQAP--RSPPTCLRCGEGVTRVEPTGLGTVFM 152
           +H C+KC  PI +YGRMIPC+HVFC  CA     +    C  C + V R+E    G++FM
Sbjct: 1   VHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFM 60

Query: 153 CTHGGARHSTAGCKRTYLSQRDLMALGRHLGPHPRLHRKDHR 194
           C+         GCKRTYLSQRDL A   H   H R  +   R
Sbjct: 61  CSI------VQGCKRTYLSQRDLQAHINHR--HMRAGKPVTR 94
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 100.0
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 97.63
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 97.57
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 97.43
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 97.43
2ect_A78 Ring finger protein 126; metal binding protein, st 97.41
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 97.36
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 97.34
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 97.21
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 97.21
2ysl_A73 Tripartite motif-containing protein 31; ring-type 97.19
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 97.16
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 97.15
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 97.15
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 97.14
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 97.14
2ecm_A55 Ring finger and CHY zinc finger domain- containing 97.1
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 97.1
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 97.09
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 97.07
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 97.06
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 97.06
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 97.05
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 97.04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 97.04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 97.01
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 96.99
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 96.98
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.97
2ea5_A68 Cell growth regulator with ring finger domain prot 96.95
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 96.95
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 96.91
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 96.91
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 96.9
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 96.9
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 96.9
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 96.78
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 96.78
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 96.75
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 96.73
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 96.71
2ecw_A85 Tripartite motif-containing protein 30; metal bind 96.7
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 96.64
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 96.63
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 96.6
2ysj_A63 Tripartite motif-containing protein 31; ring-type 96.58
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 96.54
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 96.53
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 96.47
1z6u_A150 NP95-like ring finger protein isoform B; structura 96.3
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 96.05
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 96.02
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 95.57
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 95.56
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 95.55
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 94.82
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 94.29
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 93.97
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 93.73
2jrp_A81 Putative cytoplasmic protein; two-zinc binding pro 93.14
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 91.82
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 90.31
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 90.29
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 90.27
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 89.91
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 89.86
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 89.4
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 89.39
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 89.04
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 88.54
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 88.28
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 88.18
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 87.54
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 87.43
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 87.35
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 86.99
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 86.97
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 86.76
2epa_A72 Krueppel-like factor 10; transforming growth facto 86.75
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 86.72
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 86.65
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 86.13
2lv2_A85 Insulinoma-associated protein 1; structural genomi 86.1
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 85.92
2f42_A179 STIP1 homology and U-box containing protein 1; cha 85.9
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 85.86
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 85.75
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 85.53
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 85.51
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 85.49
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 85.27
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 85.01
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 85.0
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 84.92
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 84.9
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 84.77
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 84.56
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 84.55
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 84.49
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 84.41
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 84.35
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 84.29
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 84.29
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.28
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 84.21
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 84.13
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 84.03
1ard_A29 Yeast transcription factor ADR1; transcription reg 83.96
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 83.93
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 83.92
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.92
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 83.91
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 83.85
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 83.81
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 83.68
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 83.66
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 83.56
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 83.53
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 83.29
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 83.26
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 83.2
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 83.18
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 83.17
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 83.73
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 83.11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 83.05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 83.01
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 82.91
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 82.73
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 82.7
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 82.68
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 82.67
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 82.65
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 82.56
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 82.49
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 82.46
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 82.43
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 82.35
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 83.08
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 82.11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 82.08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 81.78
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 81.73
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 81.61
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 81.52
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 81.41
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.34
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 81.3
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 81.3
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 81.16
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 81.11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 81.03
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.0
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 80.94
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.86
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 80.45
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 80.44
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 80.27
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 80.26
2jne_A101 Hypothetical protein YFGJ; zinc fingers, two zinc, 80.01
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 81.05
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=5.3e-46  Score=297.11  Aligned_cols=95  Identities=47%  Similarity=0.927  Sum_probs=87.9

Q ss_pred             ceecccCCCceEEEEeecccccccccccccC--CCCCCccCCCccceeeeeEecCCcEEEcccCCccccCccccccccCh
Q psy6453          95 IHTCEKCEKPIMIYGRMIPCRHVFCLSCAQA--PRSPPTCLRCGEGVTRVEPTGLGTVFMCTHGGARHSTAGCKRTYLSQ  172 (282)
Q Consensus        95 iHFCdkCdlPI~IYGRmIPCKHVFCy~CA~l--~k~~k~CprC~d~V~rIEq~~lgsVFMCt~gg~r~~v~gCkRTYLSQ  172 (282)
                      +||||+|++||+||||||||||||||+||.+  ++++++|++|+++|+|||++.+|+||||++      ++|||||||||
T Consensus         1 ~hfC~~C~~Pi~iygRmIPCkHvFCydCa~~~~~~~~k~Cp~C~~~V~rVe~~~~~~if~C~~------~~~CkrtyLs~   74 (101)
T 3vk6_A            1 VHFCDKCGLPIKVYGRMIPCKHVFCYDCAILHEKKGDKMCPGCSDPVQRIEQCTRGSLFMCSI------VQGCKRTYLSQ   74 (101)
T ss_dssp             CCBCTTTCSBCSEEEEEETTCCEEEHHHHHHHHHTTCCBCTTTCCBCSEEEEEEGGGCCCCCC------CCCCCCCCSSH
T ss_pred             CeecCccCCCeEEEeeeccccccHHHHHHHHHHhccCCCCcCcCCeeeeeEEeccCCEEECCC------CCCHHHHhcCH
Confidence            5999999999999999999999999999987  468999999999999999999999999998      99999999999


Q ss_pred             HhHHHHhhccCCCCCcccccccchhhhh
Q psy6453         173 RDLMALGRHLGPHPRLHRKDHRLFRALV  200 (282)
Q Consensus       173 RDLQAHInH~h~~p~~~~~~~~~~~a~~  200 (282)
                      |||||||||+|     +++++.+++++.
T Consensus        75 rdlqaHI~~~H-----~~~~~~~~~~~~   97 (101)
T 3vk6_A           75 RDLQAHINHRH-----MRAGKPVTRASL   97 (101)
T ss_dssp             HHHHHHHHHHT-----TTSCCCCCSCC-
T ss_pred             HHHHHHHHHHh-----hhcCCCCCCccc
Confidence            99999999999     788777664443
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2jne_A Hypothetical protein YFGJ; zinc fingers, two zinc, structural genomics, PSI-2, protein structure initiative; NMR {Escherichia coli} SCOP: g.41.18.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query282
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 97.81
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 97.53
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 97.41
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 96.92
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 96.83
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 96.68
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 96.65
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 96.57
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 96.53
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 95.8
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 95.18
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 94.99
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 94.97
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.67
d2c2la280 STIP1 homology and U box-containing protein 1, STU 94.65
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 94.58
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.33
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 93.52
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 93.42
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.08
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 91.92
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 91.77
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 91.21
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.68
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 85.86
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 84.46
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]

Probab=97.81  E-value=1.2e-06  Score=60.71  Aligned_cols=50  Identities=32%  Similarity=0.659  Sum_probs=40.4

Q ss_pred             ceecccCCCceEEEEeecccccccccccccC-CCCCCccCCCccceeeeeE
Q psy6453          95 IHTCEKCEKPIMIYGRMIPCRHVFCLSCAQA-PRSPPTCLRCGEGVTRVEP  144 (282)
Q Consensus        95 iHFCdkCdlPI~IYGRmIPCKHVFCy~CA~l-~k~~k~CprC~d~V~rIEq  144 (282)
                      ..-|.+|--.+....++.||.|+||.+|... -+....||.|...|..+..
T Consensus         5 ~d~C~IC~~~~~~~~~~~~C~H~Fc~~Ci~~w~~~~~~CP~CR~~i~~~~~   55 (68)
T d1chca_           5 AERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPLCKVPVESVVH   55 (68)
T ss_dssp             CCCCSSCCSCCCSCEEETTTTEEESTTHHHHHHHHSCSTTTTCCCCCCEEC
T ss_pred             CCCCccCCcCccCCcEEeCCCCcCcHHHHHHHHHhCCcCCCCCcchHhhcc
Confidence            4579999877777778899999999999975 1235689999999876654
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure