Diaphorina citri psyllid: psy6462


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230----
MQLSWRRGEKKEKELDYQEFLMLDNELFSVLPSGRKASPTSGDESSKKSKKKKHKKDKKKKSKKSKKRKKKKYSSSSSSDSSSSSEDEWVDKSAVKSSDSSHSSDSDNSDRDTVGPAPKQHVTLTQKDYGKALLPGEGAAMAAYVAEGKRIPRRGEIGLTSDEIERYEAVGYVMSGSRHRRMEAVRIRKENQIYSADEKRALAMFSKEERQKRENRILTQFKEMVSSKLAKNKD
ccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHcccc
******************EFLMLDNELF****************************************************************************************************YGKALLPGEGAAMAAYVAEGKRIPRRGEIGLTSDEIERYEAVGYVMSGSRHRRMEAVRIRKEN*************************ILTQFKE***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLSWRRGEKKEKELDYQEFLMLDNELFSVLPSGRKASPTSGDESSKKSKKKKHKKDKKKKSKKSKKRKKKKYSSSSSSDSSSSSEDEWVDKSAVKSSDSSHSSDSDNSDRDTVGPAPKQHVTLTQKDYGKALLPGEGAAMAAYVAEGKRIPRRGEIGLTSDEIERYEAVGYVMSGSRHRRMEAVRIRKENQIYSADEKRALAMFSKEERQKRENRILTQFKEMVSSKLAKNKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UPF0396 protein CG6066 confidentQ9VB74
NF-kappa-B-activating protein Acts as a transcriptional repressor. Plays a role as a transcriptional corepressor of the Notch-mediated signaling required for T-cell development. Also involved in the TNF and IL-1 induced NF-kappa-B activation. Associates with chromatin at the Notch-regulated SKP2 promoter.confidentQ8N5F7
UPF0396 protein confidentQ55ED4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031490 [MF]chromatin DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:0003682, GO:1901363
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0046638 [BP]positive regulation of alpha-beta T cell differentiationprobableGO:0046637, GO:0046635, GO:0046634, GO:0050863, GO:0045580, GO:0045582, GO:0050789, GO:0051249, GO:0050865, GO:0002684, GO:0002682, GO:0045621, GO:0065007, GO:0050867, GO:0050793, GO:0050870, GO:0050794, GO:0045597, GO:0048518, GO:0045595, GO:0008150, GO:0051239, GO:0051094, GO:0051251, GO:1902107, GO:0002694, GO:1902105, GO:0002696, GO:2000026, GO:0045619, GO:0048522
GO:0030851 [BP]granulocyte differentiationprobableGO:0032502, GO:0002376, GO:0048856, GO:0044707, GO:0008150, GO:0009987, GO:0048869, GO:0032501, GO:0030154, GO:0048731, GO:0002573, GO:0044767, GO:0048513, GO:0044763, GO:0044699, GO:0030099, GO:0030097, GO:0048534, GO:0007275, GO:0002521, GO:0002520
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0033077 [BP]T cell differentiation in thymusprobableGO:0030154, GO:0042110, GO:0045321, GO:0007275, GO:0044699, GO:0048869, GO:0048513, GO:0048534, GO:0032502, GO:0032501, GO:0030217, GO:0009987, GO:0044767, GO:0001775, GO:0046649, GO:0044763, GO:0048731, GO:0002521, GO:0002520, GO:0044707, GO:0048856, GO:0030097, GO:0002376, GO:0030098, GO:0008150
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0019827 [BP]stem cell maintenanceprobableGO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0071425 [BP]hematopoietic stem cell proliferationprobableGO:0032502, GO:0002376, GO:0032501, GO:0044707, GO:0008283, GO:0048856, GO:0007275, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0030097, GO:0072089, GO:0048534, GO:0044699, GO:0002520

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted