Diaphorina citri psyllid: psy6471

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-----

MIRFDRGNCNFYGLIVPKSKREGRQGVSSSQFCSVRDTASRLTSSGDPNPSFSLTNVKWNDVDTHEIDEKSIITYISSLYDVFPEPPAVHPLYDSESQQRVNEYCDLASSLHLWMREKTAYMQDRNFPSTLIEMKKLAADSARFRTEEVPPRQRDKQRLQHIFQDLTKYFEDVGEVDIDPELHIDVIERNWSRLLAAHQEKDSILQDEIKRLDRLQRLAEKVTREMKRVDGRLEELESRINEEARRLDRLHPLDAKHNVDVLEHDLRQAEENINTLFSDVQTLREGRYPQASDLHKRVQKLHQRWVALRSLLHSRLVSPLASMSFPVVEERTVTRQTRTVMETRLVDTNTHFRALQEAIEWVKNKLAQIQEADYGSDLQGVQAEIAIHQREQNIIAQIQEADYGSDLQGVQAEIAIHQREQNIIEQFHTRVEHCIAAKFLAMGAAQRNAIRKALNEDADKLLEEGDPSDPQLRRLRREMDEVNRLFDEFERRARAEEDMKNATKLFTEKASNLQSKLDEAERTLHSRINAPVPRDLDSLEHLVLQHKDFESTLKNLMSDLEKREIQFSAVQDRGEALILQHHPAAKCIEAYMAAMQSQWAWLLQLALCLETHLKHAAYYHQFWREMKDAETWINK

cccccccccccccccccccccccccccccccccccHHccccccccccccHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc

*IRFDRGNCNFYGLIVP******************RDTASRLTSSGDPNPSFSLTNVKWNDVDTHEIDEKSIITYISSLYDVFPEPPAVHPLYDSESQQRVNEYCDLASSLHLWMREKTAYMQDRNFPSTLIEMKKLAADSARFRTEEVPPRQRDKQRLQHIFQDLTKYFEDVGEVDIDPELHIDVIERNWSRLLAAHQEKDSILQDEIKRLDRLQRLAEKVTREMKRVDGRLEELESRI**************AKHNVDVLEHDLRQAEENINTLFSDVQTLREGRYPQASDLHKRVQKLHQRWVALRSLLHSRLVSPLASMSFPVVEERTVTRQTRTVMETRLVDTNTHFRALQEAIEWVKNKLAQIQEADYGSDLQGVQAEIAIHQREQNIIAQIQEADYGSDLQGVQAEIAIHQREQNIIEQFHTRVEHCIAAKFLAMGAAQRNAIRKALNEDADKLLEEGDPSDPQLRRLRREMDEVNRLFDEFERRARAEEDMKNATKLFTEKASNLQSKLDEAERTLH*RINAPVPRDLDSLEHLVLQHKDFESTLKNLMSDLEKREIQFSAVQDRGEALILQHHPAAKCIEAYMAAMQSQWAWLLQLALCLETHLKHAAYYHQFWREMKDAETWINK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MIRFDRGNCNFYGLIVPKSKREGRQGVSSSQFCSVRDTASRLTSSGDPNPSFSLTNVKWNDVDTHEIDEKSIITYISSLYDVFPEPPAVHPLYDSESQQRVNEYCDLASSLHLWMREKTAYMQDRNFPSTLIEMKKLAADSARFRTEEVPPRQRDKQRLQHIFQDLTKYFEDVGEVDIDPELHIDVIERNWSRLLAAHQEKDSIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLDRLHPLDAKHNxxxxxxxxxxxxxxxxxxxxxxxxxxxxRYPQASDLHKRVQKLHQRWVALRSLLHSRLVSPLASMSFPVVEERTVTRQTRTVMETRLVDTNTHxxxxxxxxxxxxxxxxxxxxxDYGSDLQGVQAEIAIHQREQNIIAQIQEADYGSDLQGVQAEIAIHQREQNIIEQFHTRVEHCIAAKFLAMGAAQRNAIRKALNEDADKLLEEGDPSDPQxxxxxxxxxxxxxxxxxxxxxxxxxxxxKNAxxxxxxxxxxxxxxxxxxxxxLHSRINAPVPRDLDSLEHLVLQHKDFESTLKNLMSDLEKREIQFSAVQDRGEALILQHHPAAKCIEAYMAAMQSQWAWLLQLALCLETHLKHAAYYHQFWREMKDAETWINK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000235 [CC]	astral microtubule	probable	GO:0043229, GO:0043228, GO:0005874, GO:0043226, GO:0005876, GO:0005737, GO:0044446, GO:0005818, GO:0005819, GO:0044430, GO:0005856, GO:0015630, GO:0005881, GO:0043234, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0030426 [CC]	growth cone	probable	GO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0045169 [CC]	fusome	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EDV, chain A
Confidence level:very confident
Coverage over the Query: 216-317,333-391,421-430,451-614
View the alignment between query and template
View the model in PyMOL

Template: 1SJJ, chain A
Confidence level:very confident
Coverage over the Query: 12-317,333-391,421-435,453-614
View the alignment between query and template
View the model in PyMOL

Template: 3PE0, chain A
Confidence level:very confident
Coverage over the Query: 501-634
View the alignment between query and template
View the model in PyMOL

Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 153-201
View the alignment between query and template
View the model in PyMOL