Diaphorina citri psyllid: psy6472

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
MKRVDGRLEELESRINEEARRLDRLHPLDAKHNVDVLEHDLRQAEENINTLFSDVQTLREGRYPQASDLHIF
cccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
*****GR*EELES*************PLDAKHNVDVLEHDLRQAEENINTLFSDVQTLREGRYPQ****HIF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxLDRLHPLDAKHNxxxxxxxxxxxxxxxxxxxxxxxxxxxxRYPQASDLHIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030426 [CC]growth coneprobableGO:0030427, GO:0044463, GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0045169 [CC]fusomeprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000235 [CC]astral microtubuleprobableGO:0043229, GO:0043228, GO:0005874, GO:0043226, GO:0005876, GO:0005737, GO:0044446, GO:0005818, GO:0005819, GO:0044430, GO:0005856, GO:0015630, GO:0005881, GO:0043234, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ODV, chain A
Confidence level:very confident
Coverage over the Query: 1-71
View the alignment between query and template
View the model in PyMOL