Diaphorina citri psyllid: psy647


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MDPAEIEFIAEDQNVEIIPKFNHLNLIHLISGDVGPFRAGIPAKVPLWLAINLKQRQKCRLVLPTWMNLETLTEIKEEEKKSRFFIKMPSDHYMEMSHIILDIGADDIPNVDLIRTLIKDIWDLRISKLRSSIDTFVKSGGGHATLNHLTQFEINSIRNILCDVLDTMSSLKDKQCDVDVTLVTSNSQSQ
ccHHHHHHHHcccCEEEECcccccccccccccccccccccccccHHHHHHHHHHccccEEEEccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccc
*DPAEIEFIAEDQNVEIIPKFNHLNLIHLISGDVGPFRAGIPAKVPLWLAINLKQRQKCRLVLPTWMNLETLTEIKEEEKKSRFFIKMPSDHYMEMSHIILDIGADDIPNVDLIRTLIKDIWDLRISKLRSSIDTFVKSGGGHATLNHLTQFEINSIRNILCDVLDTMSSLKDKQ***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPAEIEFIAEDQNVEIIPKFNHLNLIHLISGDVGPFRAGIPAKVPLWLAINLKQRQKCRLVLPTWMNLETLTEIKEEEKKSRFFIKMPSDHYMEMSHIILDIGADDIPNVDLIRTLIKDIWDLRISKLRSSIDTFVKSGGGHATLNHLTQFEINSIRNILCDVLDTMSSLKDKQCDVDVTLVTSNSQSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA replication complex GINS protein PSF2 The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.very confidentQ9Y248
Probable DNA replication complex GINS protein PSF2 The GINS complex plays an essential role in the initiation of DNA replication.very confidentQ9VQY9
DNA replication complex GINS protein PSF2 The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.very confidentQ9D600

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0032784 [BP]regulation of DNA-dependent transcription, elongationprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0006271 [BP]DNA strand elongation involved in DNA replicationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:0022616, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0043138 [MF]3'-5' DNA helicase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0003678, GO:0004386
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000811 [CC]GINS complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0031261, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005654, GO:0044454, GO:0044451, GO:0005694, GO:0043231, GO:0032991, GO:0043232, GO:0032993, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0000084 [BP]S phase of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0009987, GO:0051329, GO:0008150, GO:0022402, GO:0022403, GO:0044763, GO:0007049, GO:0051320
GO:0046331 [BP]lateral inhibitionprobableGO:0032502, GO:0044700, GO:0045165, GO:0048869, GO:0030154, GO:0045168, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0009987, GO:0044699
GO:0040035 [BP]hermaphrodite genitalia developmentprobableGO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0048806, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0006270 [BP]DNA replication initiationprobableGO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0006260, GO:0006261, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0045132 [BP]meiotic chromosome segregationprobableGO:0007126, GO:0048610, GO:0051321, GO:0000003, GO:0022402, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0007059, GO:0007049
GO:0030261 [BP]chromosome condensationprobableGO:0071103, GO:0090304, GO:0034641, GO:0006807, GO:0016043, GO:0071840, GO:0006139, GO:0044260, GO:0006323, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0044699, GO:0051276, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0001703 [BP]gastrulation with mouth forming firstprobableGO:0048598, GO:0032502, GO:0048856, GO:0044707, GO:0007369, GO:0044767, GO:0009790, GO:0032501, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0010171 [BP]body morphogenesisprobableGO:0032502, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0045750 [BP]positive regulation of S phase of mitotic cell cycleprobable
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0040007 [BP]growthprobableGO:0008150
GO:0034613 [BP]cellular protein localizationprobableGO:0008104, GO:0070727, GO:0009987, GO:0044763, GO:0008150, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E9X, chain B
Confidence level:very confident
Coverage over the Query: 1-176
View the alignment between query and template
View the model in PyMOL