Diaphorina citri psyllid: psy6481


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90----
MAAIESYQLYAYQENKNVPVNSSLWKNIGKLEALPLPMACTLTQIVLFCTKLMVPEINVISQILLLFERKFAPGGNQTHDLALRRQVCYTPTIV
ccccEEEEEEEEECcccccccccccEEEEEEcccccccEEEEEEEccccEEEEEEEEHHEEEEEEEEEccccccccccHHHHHHHccccccccc
**AIESYQLYAYQENKNVPVNSSLWKNIGKLEALPLPMACTLTQIVLFCTKLMVPEINVISQILLLFERKFAPGGNQTHDLALRRQVCYTPTIV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAIESYQLYAYQENKNVPVNSSLWKNIGKLEALPLPMACTLTQIVLFCTKLMVPEINVISQILLLFERKFAPGGNQTHDLALRRQVCYTPTIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Activating transcription factor 7-interacting protein 1 Recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Can both act as an activator or a repressor depending on the context. Mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing SETDB1. Required to stimulate histone methyltransferase activity of SETDB1 and facilitate the conversion of dimethylated to trimethylated H3 'Lys-9' (H3K9me3). The complex formed with MBD1 and SETDB1 represses transcription and couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3). May have ATPase activity.confidentQ7TT18
Activating transcription factor 7-interacting protein 1 Recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Can both act as an activator or a repressor depending on the context. Mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing histone methyltransferase activity. May belong to a complex that represses transcription and couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3).confidentA0JME2
Activating transcription factor 7-interacting protein 1 Recruiter that couples transcriptional factors to general transcription apparatus and thereby modulates transcription regulation and chromatin formation. Can both act as an activator or a repressor depending on the context. Mediates MBD1-dependent transcriptional repression, probably by recruiting complexes containing histone methyltransferase activity. May belong to a complex that represses transcription and couples DNA methylation and histone H3 'Lys-9' trimethylation (H3K9me3).confidentQ5ZIE8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006306 [BP]DNA methylationprobableGO:0019222, GO:0090304, GO:0034641, GO:0006807, GO:0050789, GO:1901360, GO:0006139, GO:0006305, GO:0006304, GO:0044260, GO:0040029, GO:0071704, GO:0065007, GO:0032259, GO:0010468, GO:0060255, GO:0009987, GO:0006725, GO:0043412, GO:0044728, GO:0043414, GO:0008152, GO:0046483, GO:0044238, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0045898 [BP]regulation of RNA polymerase II transcriptional preinitiation complex assemblyprobableGO:0060260, GO:0080090, GO:0019222, GO:0031326, GO:2001141, GO:0031323, GO:0051128, GO:0050789, GO:0006355, GO:2000112, GO:0060255, GO:0010556, GO:0065007, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2000142, GO:0043254, GO:0051252, GO:0044087, GO:0006357
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016887 [MF]ATPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0006200 [BP]ATP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0042278, GO:0071704, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0009203, GO:0044238, GO:0046034, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X5X, chain A
Confidence level:confident
Coverage over the Query: 3-59
View the alignment between query and template
View the model in PyMOL