Diaphorina citri psyllid: psy648


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
MAAVHREAIQKQIQQDWANREYIEIITGSIKKITDFLNSFDMSCRSRLAVLNEKLTTLERRIEYLEARKSHG
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
***********QIQQDWANREYIEIITGSIKKITDFLNSFDMSCRSRLAVLNEKLTTLERRIEYLEARKS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAVHREAIQKQIQQDWANREYIEIITGSIKKITDFLNSFDMSCRSRxxxxxxxxxxxxxxxxxxxxxKSHG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein BRICK1 Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex.very confidentQ8WUW1
Probable protein BRICK1 Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex.very confidentQ6IQ86
Protein BRICK1 Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex.very confidentQ91VR8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008582 [BP]regulation of synaptic growth at neuromuscular junctionconfidentGO:0048638, GO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0048634, GO:0051128, GO:0032501, GO:0023052, GO:0051147, GO:0050789, GO:0044699, GO:0040008, GO:0060284, GO:0065007, GO:0048641, GO:0065008, GO:1901861, GO:0016202, GO:0009987, GO:0050793, GO:0050877, GO:0048742, GO:0050794, GO:0051153, GO:0045595, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0051963, GO:0044087, GO:0051960, GO:2000026, GO:0044763
GO:0051491 [BP]positive regulation of filopodium assemblyconfidentGO:0051130, GO:0051489, GO:0051128, GO:0050789, GO:0044087, GO:0060491, GO:0065007, GO:0048518, GO:0008150, GO:0031346, GO:0031344, GO:0050794, GO:0048522
GO:0008360 [BP]regulation of cell shapeconfidentGO:0022604, GO:0022603, GO:0050793, GO:0051128, GO:0065007, GO:0008150, GO:0065008, GO:0050789, GO:0050794
GO:0048870 [BP]cell motilityconfidentGO:0040011, GO:0009987, GO:0006928, GO:0051674, GO:0008150, GO:0044763, GO:0051179, GO:0044699
GO:0005856 [CC]cytoskeletonconfidentGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0021551 [BP]central nervous system morphogenesisconfidentGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0007417
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0001701 [BP]in utero embryonic developmentconfidentGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0008284 [BP]positive regulation of cell proliferationconfidentGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0030036 [BP]actin cytoskeleton organizationconfidentGO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0010592 [BP]positive regulation of lamellipodium assemblyconfidentGO:0010591, GO:0051130, GO:0051128, GO:0050789, GO:0044087, GO:0060491, GO:0065007, GO:0048518, GO:0008150, GO:0031346, GO:0031344, GO:0050794, GO:0048522
GO:0032433 [CC]filopodium tipprobableGO:0005575, GO:0044463, GO:0044464, GO:0005623, GO:0030175, GO:0042995
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0031143 [CC]pseudopodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0031209 [CC]SCAR complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008064 [BP]regulation of actin polymerization or depolymerizationprobableGO:0030832, GO:0065008, GO:0033043, GO:0071840, GO:0032970, GO:0051493, GO:0016043, GO:0090066, GO:0051128, GO:0065007, GO:0044763, GO:0044699, GO:0032956, GO:0008150, GO:0009987, GO:0050794, GO:0050789, GO:0032535
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3P8C, chain E
Confidence level:very confident
Coverage over the Query: 11-72
View the alignment between query and template
View the model in PyMOL