Diaphorina citri psyllid: psy6496

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MGPKKGSGKSSKDKEEDSSGKQKKGGTAVKVRHILCEKQSKVLEALEKLKSGVKFPEVASQYSEDKARQGGDLGWMVRGSMVGEFQDAAFKLPISTVNNPVYTEPPIKTKFGYHIIMVEGKK
cccccccccccHHHHHHHHccccccccEEEEEEEEEccHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccccccccccccccccEEEEEEEEEc
***************************AVKVRHILCEKQSKVLEALEKLKSGVKFPE*************GDLGWMVRGSMVGEFQDAAFKLPISTVNNPVYTEPPIKTKFGYHIIMVEGK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGPKKGSGKSSKDKEEDSSGKQKKGGTAVKVRHILCEKQSKVLEALEKLKSGVKFPEVASQYSEDKARQGGDLGWMVRGSMVGEFQDAAFKLPISTVNNPVYTEPPIKTKFGYHIIMVEGKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 May be involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to DNA.very confidentQ503Y7
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 May be involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to DNA.very confidentQ6P4K8
Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4 Involved as a ribosomal RNA processing factor in ribosome biogenesis. Binds to tightly bent AT-rich stretches of double-stranded DNA.very confidentQ9CWW6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030684 [CC]preribosomeconfidentGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003690 [MF]double-stranded DNA bindingconfidentGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003681 [MF]bent DNA bindingconfidentGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0006364 [BP]rRNA processingprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0003755 [MF]peptidyl-prolyl cis-trans isomerase activityprobableGO:0003824, GO:0003674, GO:0016853, GO:0016859
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UI4, chain A
Confidence level:very confident
Coverage over the Query: 26-122
View the alignment between query and template
View the model in PyMOL