Diaphorina citri psyllid: psy6503


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60
MVIYLGHFTQVVWKSSSKLGVGIARKNGHILVVANYDPPGNYQGQYANNNLEGNLMETWA
ccccccEEEEEEEccccEEEEEEEECcccEEEEEEEcccccccccccccccccccccccc
MVIYLGHFTQVVWKSSSKLGVGIARKNGHILVVANYDPPGNYQGQYANNNLEG*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVIYLGHFTQVVWKSSSKLGVGIARKNGHILVVANYDPPGNYQGQYANNNLEGNLMETWA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein PRY1 confidentP47032

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000324 [CC]fungal-type vacuoleprobableGO:0005737, GO:0000323, GO:0000322, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AIW, chain A
Confidence level:very confident
Coverage over the Query: 2-55
View the alignment between query and template
View the model in PyMOL