Diaphorina citri psyllid: psy6521


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80---
MNSAFRCIQSKNPCKLAFSLNVAKINSNILSTIPVRYAGHSKWQNIRHIKAAKDQEKATLFTNLSKKLKLAVKVTHQYVVLPN
ccccccHHcccccccHHcccccccccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
*****RCIQSKNPCKLAFSLNVAKINSNILSTIPVRYAGHSKWQNIRHIKAAKDQEKATLFTNLSKKLKLAVKVTHQYVVL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSAFRCIQSKNPCKLAFSLNVAKINSNILSTIPVRYAGHSKWQNIRHIKAAKDQEKATLFTNLSKKLKLAVKVTHQYVVLPN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable transcriptional regulatory protein Nther_1800 confidentB2A5L8
Probable transcriptional regulatory protein HNE_0161 confidentQ0C5U8
Probable transcriptional regulatory protein Dshi_2762 confidentA8LJ00

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KON, chain A
Confidence level:very confident
Coverage over the Query: 39-74
View the alignment between query and template
View the model in PyMOL