Score = 59.7 bits (143), Expect = 2e-07, Method: Compositional matrix adjust.
Identities = 26/51 (50%), Positives = 38/51 (74%)
Query: 23 AKINSNILSTIPVRYAGHSKWQNIRHIKAAKDQEKATLFTNLSKKLKLAVK 73
++ N ++++ I R+AGHSKW NI+H+K AKDQ +A+LF LS K+ LA K
Sbjct: 20 SRCNFDVVNQISKRWAGHSKWSNIKHVKMAKDQARASLFNKLSYKISLAAK 70
Source: Pediculus humanus corporis
Species: Pediculus humanus
Genus: Pediculus
Family: Pediculidae
Order: Phthiraptera
Class: Insecta
Phylum: Arthropoda
Superkingdom: Eukaryota
>gi|91085333|ref|XP_970254.1| PREDICTED: similar to AGAP001629-PA [Tribolium castaneum] gi|270008427|gb|EFA04875.1| hypothetical protein TcasGA2_TC014933 [Tribolium castaneum]
This model describes a minimally characterized protein family, restricted to bacteria excepting for some eukaryotic sequences that have possible transit peptides. YebC from E. coli is crystallized, and PA0964 from Pseudomonas aeruginosa has been shown to be a sequence-specific DNA-binding regulatory protein [Regulatory functions, DNA interactions]. Length = 238
This is a family of transcriptional regulators. In mammals, it activates the transcription of mitochondrially-encoded COX1. In bacteria, it negatively regulates the quorum-sensing response regulator by binding to its promoter region. Length = 234
This model describes a minimally characterized protein family, restricted to bacteria excepting for some eukaryotic sequences that have possible transit peptides. YebC from E. coli is crystallized, and PA0964 from Pseudomonas aeruginosa has been shown to be a sequence-specific DNA-binding regulatory protein.
>COG0217 Uncharacterized conserved protein [Function unknown]
>PF01709 Transcrip_reg: Transcriptional regulator; InterPro: IPR002876 This entry represents the core region of several hypothetical proteins found in bacteria, plants, and yeast proteins
This core region can be subdivided into three domains: a 3-helical bundle domain, and two alpha+beta domains with different folds, where domain 3 (ferredoxin-like fold) is inserted within domain 2. This core region is found in the following hypothetical proteins: YebC from Escherichia coli, HP0162 from Helicobacter pylori (Campylobacter pylori) and aq1575 from Aquifex aeolicus []. The crystal structure of a conserved hypothetical protein, Aq1575, from Aquifex aeolicus has been determined. A structural homology search reveals that this protein has a new fold with no obvious similarity to those of other proteins of known three-dimensional structure. The protein reveals a monomer consisting of three domains arranged along a pseudo threefold symmetry axis. There is a large cleft with approximate dimensions of 10 A x 10 A x 20 A in the centre of the three domains along the symmetry axis. Two possible active sites are suggested based on the structure and multiple sequence alignment. There are several highly conserved residues in these putative active sites [].; PDB: 1LFP_A 1MW7_A 1KON_A.