Diaphorina citri psyllid: psy6533


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------
EEEEEDEKKKKKKKKKEEEEKKQKKQKKKKKKVNKVKPVHIIFYRDGVSEGQFQAVMRRCGPCSNRSVAGLSYTIFTGAEISAIKRACQGVEANYNPKVTFLVVQKRHHTRFFPTSPSEGDGSRNNNVRPGTIVDTTITHPTDLDFYLVSHQSIQVGILTQCIKEKTVFKMNPATTGNILLKINAKLNGINHYVNKVKPVHIIFYRDGVSEGQFQAVMSAEISAIKRACQGVEANYNPKVTFLVVQKRHHTRFFPTSPSEGDGSRNNNVRPGTIVDTTITHPTDLDFYLVSHQSIQGTARPTKYYRLWDEYNLTDDETEEMTYYLCHLFSRCTRSVSYPAPTYYAHLAAFRGRVYIKNRHLDMNNLPRENQVHQANAEFLTNNPMYF
cHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHccccccccEEEEEEEcccccccccccccccccccccccccEEEEEEECcccccccccccEEEEEEcccccccEEEEEEEECcccccHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccccccccccCEEcccccccccccEEEccccccccccccccEEEEEccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccccccccccHHcccccccccccccc
*******************EKKQKKQKKKKKKVNKVKPVHIIFYRDGVSEGQFQAVMRRCGPCSNRSVAGLSYTIFTGAEISAIKRACQGVEANYNPKVTFLVVQKRHHTRFFPTS*********NNVRPGTIVDTTITHPTDLDFYLVSHQSIQVGILTQCIKEKTVFKMNPATTGNILLKINAKLNGINHYVNKVKPVHIIFYRDGVSEGQFQAVMSAEISAIKRACQGVEANYNPKVTFLVVQKRHHTRFFPT***********NVRPGTIVDTTITHPTDLDFYLVSHQSIQGTARPTKYYRLWDEYNLTDDETEEMTYYLCHLFSRCTRSVSYPAPTYYAHLAAFRGRVYIKN**********************TNNPMYF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKPVHIIFYRDGVSEGQFQAVMRRCGPCSNRSVAGLSYTIFTGAEISAIKRACQGVEANYNPKVTFLVVQKRHHTRFFPTSPSEGDGSRNNNVRPGTIVDTTITHPTDLDFYLVSHQSIQVGILTQCIKEKTVFKMNPATTGNILLKINAKLNGINHYVNKVKPVHIIFYRDGVSEGQFQAVMSAEISAIKRACQGVEANYNPKVTFLVVQKRHHTRFFPTSPSEGDGSRNNNVRPGTIVDTTITHPTDLDFYLVSHQSIQGTARPTKYYRLWDEYNLTDDETEEMTYYLCHLFSRCTRSVSYPAPTYYAHLAAFRGRVYIKNRHLDMNNLPRENQVHQANAEFLTNNPMYF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein argonaute-2 Required for RNA-mediated gene silencing (RNAi) by the RNA-induced silencing complex (RISC). The 'minimal RISC' appears to include EIF2C2/AGO2 bound to a short guide RNA such as a microRNA (miRNA) or short interfering RNA (siRNA). These guide RNAs direct RISC to complementary mRNAs that are targets for RISC-mediated gene silencing. The precise mechanism of gene silencing depends on the degree of complementarity between the miRNA or siRNA and its target. Binding of RISC to a perfectly complementary mRNA generally results in silencing due to endonucleolytic cleavage of the mRNA specifically by EIF2C2/AGO2. Binding of RISC to a partially complementary mRNA results in silencing through inhibition of translation, and this is independent of endonuclease activity. May inhibit translation initiation by binding to the 7-methylguanosine cap, thereby preventing the recruitment of the translation initiation factor eIF4-E. May also inhibit translation initiation via interaction with EIF6, which itself binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit. The inhibition of translational initiation leads to the accumulation of the affected mRNA in cytoplasmic processing bodies (P-bodies), where mRNA degradation may subsequently occur. In some cases RISC-mediated translational repression is also observed for miRNAs that perfectly match the 3' untranslated region (3'-UTR). Can also up-regulate the translation of specific mRNAs under certain growth conditions. Binds to the AU element of the 3'-UTR of the TNF (TNF-alpha) mRNA and up-regulates translation under conditions of serum starvation. Also required for transcriptional gene silencing (TGS), in which short RNAs known as antigene RNAs or agRNAs direct the transcriptional repression of complementary promoter regions.confidentQ9QZ81
Protein argonaute-2 Required for RNA-mediated gene silencing (RNAi) by the RNA-induced silencing complex (RISC). The 'minimal RISC' appears to include EIF2C2/AGO2 bound to a short guide RNA such as a microRNA (miRNA) or short interfering RNA (siRNA). These guide RNAs direct RISC to complementary mRNAs that are targets for RISC-mediated gene silencing. The precise mechanism of gene silencing depends on the degree of complementarity between the miRNA or siRNA and its target. Binding of RISC to a perfectly complementary mRNA generally results in silencing due to endonucleolytic cleavage of the mRNA specifically by EIF2C2/AGO2. Binding of RISC to a partially complementary mRNA results in silencing through inhibition of translation, and this is independent of endonuclease activity. May inhibit translation initiation by binding to the 7-methylguanosine cap, thereby preventing the recruitment of the translation initiation factor eIF4-E. May also inhibit translation initiation via interaction with EIF6, which itself binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit. The inhibition of translational initiation leads to the accumulation of the affected mRNA in cytoplasmic processing bodies (P-bodies), where mRNA degradation may subsequently occur. In some cases RISC-mediated translational repression is also observed for miRNAs that perfectly match the 3' untranslated region (3'-UTR). Can also up-regulate the translation of specific mRNAs under certain growth conditions. Binds to the AU element of the 3'-UTR of the TNF (TNF-alpha) mRNA and up-regulates translation under conditions of serum starvation. Also required for transcriptional gene silencing (TGS), in which short RNAs known as antigene RNAs or agRNAs direct the transcriptional repression of complementary promoter regions.confidentQ9UKV8
Protein argonaute-2 (Fragment) Required for RNA-mediated gene silencing (RNAi) by the RNA-induced silencing complex (RISC). The 'minimal RISC' appears to include EIF2C2/AGO2 bound to a short guide RNA such as a microRNA (miRNA) or short interfering RNA (siRNA). These guide RNAs direct RISC to complementary mRNAs that are targets for RISC-mediated gene silencing. The precise mechanism of gene silencing depends on the degree of complementarity between the miRNA or siRNA and its target. Binding of RISC to a perfectly complementary mRNA generally results in silencing due to endonucleolytic cleavage of the mRNA specifically by EIF2C2/AGO2. Binding of RISC to a partially complementary mRNA results in silencing through inhibition of translation, and this is independent of endonuclease activity. May inhibit translation initiation by binding to the 7-methylguanosine cap, thereby preventing the recruitment of the translation initiation factor eIF4-E. May also inhibit translation initiation via interaction with EIF6, which itself binds to the 60S ribosomal subunit and prevents its association with the 40S ribosomal subunit. The inhibition of translational initiation leads to the accumulation of the affected mRNA in cytoplasmic processing bodies (P-bodies), where mRNA degradation may subsequently occur. In some cases RISC-mediated translational repression is also observed for miRNAs that perfectly match the 3' untranslated region (3'-UTR). Can also up-regulate the translation of specific mRNAs under certain growth conditions. Binds to the AU element of the 3'-UTR of the TNF (TNF-alpha) mRNA and up-regulates translation under conditions of serum starvation. Also required for transcriptional gene silencing (TGS), in which short RNAs known as antigene RNAs or agRNAs direct the transcriptional repression of complementary promoter regions.confidentO77503

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035278 [BP]negative regulation of translation involved in gene silencing by miRNAprobableGO:0009892, GO:0080090, GO:0009890, GO:0051246, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0050789, GO:0044699, GO:0051248, GO:0010605, GO:0019222, GO:0010608, GO:2000112, GO:2000113, GO:0016458, GO:0065007, GO:0045974, GO:0010468, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0016441, GO:0044763, GO:0031047, GO:0048519, GO:0040033, GO:0032269, GO:0032268, GO:0035194, GO:0035195, GO:0010556, GO:0017148, GO:0006417, GO:0008150, GO:0010558, GO:0048523
GO:0000932 [CC]cytoplasmic mRNA processing bodyprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0035068 [CC]micro-ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0000340 [MF]RNA 7-methylguanosine cap bindingprobableGO:0000339, GO:0003674, GO:0005488, GO:0003676, GO:0097159, GO:1901363, GO:0003723
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007219 [BP]Notch signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0007276 [BP]gamete generationprobableGO:0044702, GO:0000003, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0048609
GO:0043186 [CC]P granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0060293, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226, GO:0045495
GO:0035198 [MF]miRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0019827 [BP]stem cell maintenanceprobableGO:0030154, GO:0048468, GO:0050789, GO:0044699, GO:0048863, GO:0048864, GO:0048869, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0044767, GO:0045596, GO:0045595, GO:0008150, GO:0051093, GO:0044707, GO:0048856, GO:0044763, GO:0048523
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016442 [CC]RNA-induced silencing complexprobableGO:0032991, GO:0031332, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0070578 [CC]RISC-loading complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0035197 [MF]siRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0034584 [MF]piRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0022412 [BP]cellular process involved in reproduction in multicellular organismprobableGO:0032501, GO:0000003, GO:0032504, GO:0009987, GO:0048610, GO:0008150
GO:0031054 [BP]pre-miRNA processingprobableGO:0009892, GO:0019222, GO:0050896, GO:0040029, GO:0090304, GO:0031050, GO:0010629, GO:0006807, GO:0070887, GO:0034660, GO:0050789, GO:0044699, GO:0070918, GO:0006139, GO:0051716, GO:0010605, GO:0044260, GO:0071359, GO:0010608, GO:1901360, GO:0010467, GO:0071704, GO:0016458, GO:0065007, GO:0014070, GO:0048519, GO:0010468, GO:0034470, GO:0060255, GO:0009987, GO:0006725, GO:0071310, GO:0044763, GO:0031047, GO:0008152, GO:0042221, GO:0010033, GO:0046483, GO:0016070, GO:0044238, GO:0035194, GO:0035195, GO:0035196, GO:1901699, GO:0034641, GO:0044237, GO:0043170, GO:0043331, GO:0071407, GO:0016441, GO:0008150, GO:1901698, GO:0006396
GO:0003006 [BP]developmental process involved in reproductionprobableGO:0032502, GO:0022414, GO:0008150, GO:0000003
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0000956 [BP]nuclear-transcribed mRNA catabolic processprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0045947 [BP]negative regulation of translational initiationprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:2000112, GO:0031324, GO:0031323, GO:0050789, GO:0051248, GO:0010605, GO:0019222, GO:0010608, GO:0051246, GO:2000113, GO:0065007, GO:0031326, GO:0048519, GO:0010468, GO:0060255, GO:0006446, GO:0009889, GO:0050794, GO:0008150, GO:0032269, GO:0032268, GO:0010556, GO:0017148, GO:0006417, GO:0010558, GO:0048523
GO:0005845 [CC]mRNA cap binding complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0034518, GO:0044424
GO:0005844 [CC]polysomeprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0030529
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0033169 [BP]histone H3-K9 demethylationprobableGO:0008214, GO:0044699, GO:0044267, GO:0006482, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016577, GO:0016570, GO:0006996, GO:0009987, GO:0044710, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0070988, GO:0044238, GO:0051276, GO:0070076, GO:0019538, GO:0044237, GO:0043170, GO:0044763, GO:0016568, GO:0016569
GO:0009791 [BP]post-embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0008150, GO:0007275, GO:0044699
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0070551 [MF]endoribonuclease activity, cleaving siRNA-paired mRNAprobableGO:0016787, GO:0003824, GO:0004518, GO:0004519, GO:0004540, GO:0004521, GO:0016788, GO:0016893, GO:0016891, GO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F3T, chain A
Confidence level:very confident
Coverage over the Query: 36-359
View the alignment between query and template
View the model in PyMOL
Template: 4F3T, chain A
Confidence level:very confident
Coverage over the Query: 10-58,79-185
View the alignment between query and template
View the model in PyMOL