Diaphorina citri psyllid: psy6542


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330----
MGMLRRRPRESRVSKWRVKPPSLKPLGFPIQIGMLRHRPHESRVAKWRPYIQEIFNHLRNEPFKKCVLLFKMNLYKVTSEPNSHYIIGVRQSGPKDQISRSKINRYHKKLRKCFIRRTVQLLEPVHTCHSALNKNPLIAIFLTLSVPCLHFRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVESDCILHGYIKKLGGPFVSAWQTRYAKLFPNRLELHPESGQSKPELIFMDQIEEVSQDLITVKGEQCVQLKLTRDTRIVLTNPVSQIKGPFPHVDEIGLKEWSLSLRSAHKCSQELLGSMARKAGKIYGTTDREKNSILGTRTANGN
ccccccccccccccccECcccccccccccEEEEECcccccccccccccHHHHHHHHHHHcccHHHHEEEEEEEEEEEEccccCEEEEEEEEcccccccccccccccccccccEEEEccccccHHHHHHHccccccHHHHHHHHcccccccccccccccEEEcccccEEECcccccccccccccccccccccccHHHHHHcccccccccccccEEEcccccccccccccccccccHHcccccccccccccccccEEEEEEEccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccc
*******************PPSLKPLGFPIQIGMLRHRPHESRVAKWRPYIQEIFNHLRNEPFKKCVLLFKMNLYKVTSEPNSHYIIGVRQSGPKDQISRSKINRYHKKLRKCFIRRTVQLLEPVHTCHSALNKNPLIAIFLTLSVPCLHFRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVESDCILHGYIKKLGGPFVSAWQTRYAKLFPNRLEL**********LIFMDQIEEVSQDLITVKGEQCVQLKLTRDTRIVLTNPVSQIKGPFPHVDEIGLKEWSLSLRSAHKCSQELL******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGMLRRRPRESRVSKWRVKPPSLKPLGFPIQIGMLRHRPHESRVAKWRPYIQEIFNHLRNEPFKKCVLLFKMNLYKVTSEPNSHYIIGVRQSGPKDQISRSKINRYHKKLRKCFIRRTVQLLEPVHTCHSALNKNPLIAIFLTLSVPCLHFRDLKPANILLDEHGHVRISDLGLACDFSKKKPHASVESDCILHGYIKKLGGPFVSAWQTRYAKLFPNRLELHPESGQSKPELIFMDQIEEVSQDLITVKGEQCVQLKLTRDTRIVLTNPVSQIKGPFPHVDEIGLKEWSLSLRSAHKCSQELLGSMARKAGKIYGTTDREKNSILGTRTANGN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
G protein-coupled receptor kinase 1 Specifically phosphorylates the activated forms of G protein-coupled receptors.confidentP32865

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035091 [MF]phosphatidylinositol bindingprobableGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XJD, chain A
Confidence level:very confident
Coverage over the Query: 12-132,149-270
View the alignment between query and template
View the model in PyMOL
Template: 3A7I, chain A
Confidence level:confident
Coverage over the Query: 12-132,149-270,283-310
View the alignment between query and template
View the model in PyMOL
Template: 3P86, chain A
Confidence level:confident
Coverage over the Query: 12-132,147-172,188-233,252-312
View the alignment between query and template
View the model in PyMOL
Template: 3PVU, chain A
Confidence level:confident
Coverage over the Query: 186-270,282-314
View the alignment between query and template
View the model in PyMOL