Diaphorina citri psyllid: psy6565


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-----
MVMIGEDTLLRFSGVPLGEACTIVIRGATQQIIDEADRSLHDALCVLAATVRETRVVYGGGCSEMLMAVAISNEATRTPGKEAVAMEAFARSLAMLPTTIADNAGYDSAQLVSELRAAHASGKSTAGLDMDQGKVGDMSQLGITESYVVKRQVLTSASEAAEMILRVDNIIKAAPRKRTEDRGHC
cCEECccEEEEECccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
MVMIGEDTLLRFSGVPLGEACTIVIRGATQQIIDEADRSLHDALCVLAATVRETRVVYGGGCSEMLMAVAISNEATRTPGKEAVAMEAFARSLAMLPTTIADNAGYDSAQLVSELRAAHASGKSTAGLDMDQGKVGDMSQLGITESYVVKRQVLTSASEAAEMILRVDNII**************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMIGEDTLLRFSGVPLGEACTIVIRGATQQIIDEADRSLHDALCVLAATVRETRVVYGGGCSEMLMAVAISNEATRTPGKEAVAMEAFARSLAMLPTTIADNAGYDSAQLVSELRAAHASGKSTAGLDMDQGKVGDMSQLGITESYVVKRQVLTSASEAAEMILRVDNIIKAAPRKRTEDRGHC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
T-complex protein 1 subunit beta Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.confidentP80314
T-complex protein 1 subunit beta Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.confidentP78371
T-complex protein 1 subunit beta Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.confidentQ5XIM9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043234 [CC]protein complexconfidentGO:0005575, GO:0032991
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005832 [CC]chaperonin-containing T-complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0005829, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044445, GO:0044424
GO:0002199 [CC]zona pellucida receptor complexprobableGO:0043234, GO:0005575, GO:0032991
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007339 [BP]binding of sperm to zona pellucidaprobableGO:0008037, GO:0048610, GO:0009988, GO:0000003, GO:0044707, GO:0032501, GO:0009987, GO:0009566, GO:0035036, GO:0019953, GO:0022414, GO:0044702, GO:0044763, GO:0007338, GO:0008150, GO:0044699
GO:0072686 [CC]mitotic spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0097223 [CC]sperm partprobableGO:0005575, GO:0044464, GO:0005623
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0051298 [BP]centrosome duplicationprobableGO:0006996, GO:0031023, GO:0007010, GO:0051297, GO:0009987, GO:0007098, GO:0016043, GO:0008150, GO:0000226, GO:0007017, GO:0044763, GO:0044699, GO:0071840, GO:0022402, GO:0007049
GO:0051082 [MF]unfolded protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051131 [BP]chaperone-mediated protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0043623, GO:0071840
GO:0046658 [CC]anchored to plasma membraneprobableGO:0031226, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224, GO:0031225
GO:0007052 [BP]mitotic spindle organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0070121 [BP]Kupffer's vesicle developmentprobableGO:0044767, GO:0032502, GO:0048856, GO:0008150, GO:0044699
GO:0032402 [BP]melanosome transportprobableGO:0051875, GO:0051656, GO:0051234, GO:0043473, GO:0009987, GO:0006810, GO:0033059, GO:0051179, GO:0051905, GO:0051904, GO:0044765, GO:0008150, GO:0051640, GO:0051648, GO:0051649, GO:0044763, GO:0032401, GO:0032400, GO:0051650, GO:0044699, GO:0051641
GO:0016235 [CC]aggresomeprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0016234, GO:0044424
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0031122 [BP]cytoplasmic microtubule organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0071822, GO:0043933, GO:0009987, GO:0016043, GO:0008150, GO:0000226, GO:0071840, GO:0044763, GO:0044699
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0030054 [CC]cell junctionprobableGO:0005575
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0051086 [BP]chaperone mediated protein folding independent of cofactorprobableGO:0071704, GO:0044267, GO:0009987, GO:0006457, GO:0044260, GO:0044238, GO:0051084, GO:0006458, GO:0044237, GO:0043170, GO:0019538, GO:0008150, GO:0008152, GO:0061077
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045111 [CC]intermediate filament cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IYG, chain B
Confidence level:very confident
Coverage over the Query: 2-176
View the alignment between query and template
View the model in PyMOL