Diaphorina citri psyllid: psy6604


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MDKLVILFGTEILNIIPGRVSTEVDASLKLKDYTVVVADTGDFEAMKKYKPTDATTNPSLILQAATMPQYQHLINKAVEFGKQNG
ccHHHHHHcHHHHcccccccHHHHHHHHHHHcccEEEEEcccHHHHHccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHcc
*DKLVILFGTEILNIIPGRVSTEVDASLKLKDYTVVVADTGDFEAMKKYKPTDATTNPSLILQAATMPQYQHLINKAVEFGKQ**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKLVILFGTEILNIIPGRVSTEVDASLKLKDYTVVVADTGDFEAMKKYKPTDATTNPSLILQAATMPQYQHLINKAVEFGKQNG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transaldolase Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.confidentB3GZQ2
Transaldolase Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.confidentA5UIP9
Transaldolase Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway.confidentB1ZUE6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048029 [MF]monosaccharide bindingprobableGO:0003674, GO:0030246, GO:0005488
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0006002 [BP]fructose 6-phosphate metabolic processprobableGO:1901135, GO:0009987, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637
GO:0019682 [BP]glyceraldehyde-3-phosphate metabolic processprobableGO:0044710, GO:0006081, GO:1901135, GO:0009987, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637
GO:0009052 [BP]pentose-phosphate shunt, non-oxidative branchprobableGO:0019321, GO:0019320, GO:0006739, GO:0046365, GO:0006733, GO:0006732, GO:0034641, GO:0006098, GO:0046496, GO:0072524, GO:1901360, GO:0006139, GO:0044710, GO:0051186, GO:0071704, GO:0055086, GO:0046483, GO:0044281, GO:0006740, GO:0006725, GO:0009987, GO:0019318, GO:1901575, GO:0009117, GO:0008152, GO:0044723, GO:1901564, GO:0009056, GO:0055114, GO:0044724, GO:0044238, GO:0006753, GO:0005975, GO:0005996, GO:0016052, GO:0044237, GO:0006796, GO:0006807, GO:0006793, GO:0019637, GO:0008150, GO:0006006, GO:0006007, GO:0019362
GO:0004801 [MF]sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016744
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E1D, chain A
Confidence level:very confident
Coverage over the Query: 25-85
View the alignment between query and template
View the model in PyMOL
Template: 2E1D, chain A
Confidence level:very confident
Coverage over the Query: 1-72
View the alignment between query and template
View the model in PyMOL