Diaphorina citri psyllid: psy6612


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-
MRKISIKRIDPEIIEVKHSVAVTSAYKKIGNHVVLKGLNLNVPENKIYGLLGPSGCGKTTLLNCIVGRNTLDAGTIKLSFRQISDIGYMPQELALHGELSIRETFRYYGYMFDMTDDQIETRSKEILKLLELPPAKKIVGALSGGQQRRISFAVSLLHNPKLLILDEPTVGLDPILSQIIWDRLKEMALNGKTIIITTHYIEEAKGAHNIGLMRDDQYIGRLVHHDIVESLVEALEDALRHGNVINKVDLVDGRGSIDEVLSRQCTVSVDVDRPAINEGDYVWTQLEKGYR
ccccccccccccccccccEEEEcccEEEEccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEcccccccEEEEcccccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHccEEEEECccCEEEEccHHHHHHHHHHHHHHHHHHcccccccccccccccccCECccccEEEECcccccccccccHHHHHHcccc
*******RID****EVKHSVAVTSAYKKIGNHVVLKGLNLNVPENKIYGLLGPSGCGKTTLLNCIVGRNTLDAGTIKLSFRQISDIGYMPQELALHGELSIRETFRYYGYMFDMTDDQIETRSKEILKLLELPPAKKIVGALSGGQQRRISFAVSLLHNPKLLILDEPTVGLDPILSQIIWDRLKEMALNGKTIIITTHYIEEAKGAHNIGLMRDDQYIGRLVHHDIVESLVEALEDALRHGNVINKVDLVDGRGSIDEVLSRQCTVSVDVDRPAINEGDYVWTQLEK***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKISIKRIDPEIIEVKHSVAVTSAYKKIGNHVVLKGLNLNVPENKIYGLLGPSGCGKTTLLNCIVGRNTLDAGTIKLSFRQISDIGYMPQELALHGELSIRETFRYYGYMFDMTDDQIETRSKEILKLLELPPAKKIVGALSGGQQRRISFAVSLLHNPKLLILDEPTVGLDPILSQIIWDRLKEMALNGKTIIITTHYIEEAKGAHNIGLMRDDQYIGRLVHHDIVESLVEALEDALRHGNVINKVDLVDGRGSIDEVLSRQCTVSVDVDRPAINEGDYVWTQLEKGYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nod factor export ATP-binding protein I Part of the ABC transporter complex NodIJ involved in the export of the nodulation factors (Nod factors), the bacterial signal molecules that induce symbiosis and subsequent nodulation induction. Nod factors are LCO (lipo-chitin oligosaccharide), a modified beta-1,4-linked N-acetylglucosamine oligosaccharide. This subunit is responsible for energy coupling to the transport system.confidentQ39GT7
Nod factor export ATP-binding protein I Part of the ABC transporter complex NodIJ involved in the export of the nodulation factors (Nod factors), the bacterial signal molecules that induce symbiosis and subsequent nodulation induction. Nod factors are LCO (lipo-chitin oligosaccharide), a modified beta-1,4-linked N-acetylglucosamine oligosaccharide. This subunit is responsible for energy coupling to the transport system.confidentQ8KLG1
Nod factor export ATP-binding protein I Part of the ABC transporter complex NodIJ involved in the export of the nodulation factors (Nod factors), the bacterial signal molecules that induce symbiosis and subsequent nodulation induction. Nod factors are LCO (lipo-chitin oligosaccharide), a modified beta-1,4-linked N-acetylglucosamine oligosaccharide. This subunit is responsible for energy coupling to the transport system.confidentP26050

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0015437 [MF]lipopolysaccharide-transporting ATPase activityprobableGO:0003674, GO:0016887, GO:0042626, GO:0016820, GO:0022884, GO:0042623, GO:0015399, GO:0022804, GO:0005319, GO:0016787, GO:0005215, GO:0017111, GO:0003824, GO:0022891, GO:0015221, GO:0016818, GO:0022892, GO:0043492, GO:0016817, GO:0016462, GO:0022857, GO:1901505, GO:0015405
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0046677 [BP]response to antibioticprobableGO:0008150, GO:0042221, GO:0050896, GO:0009636
GO:0006869 [BP]lipid transportprobableGO:0051234, GO:0006810, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0051179, GO:0044699
GO:0043190 [CC]ATP-binding cassette (ABC) transporter complexprobableGO:0043234, GO:0044425, GO:0016020, GO:0032991, GO:0005575
GO:0055085 [BP]transmembrane transportprobableGO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IW3, chain A
Confidence level:very confident
Coverage over the Query: 17-221
View the alignment between query and template
View the model in PyMOL
Template: 2GHI, chain A
Confidence level:very confident
Coverage over the Query: 7-229
View the alignment between query and template
View the model in PyMOL
Template: 3G60, chain A
Confidence level:probable
Coverage over the Query: 34-232
View the alignment between query and template
View the model in PyMOL