Diaphorina citri psyllid: psy6613

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510

MVVGSAESNFSQPSSDLSLDEEKETLRREKERQALSQLEKARAKNVAFAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQTQARNPKLYSSKTSSTSNLGALSSDAPSPGMIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWRATHPPAAPPQPLTLLPPRQLTAHQSVVIPPSPSMGSAESNFSQPSSDLSLDEEKETLRREKERQALSQLEKARVTDDNESIGNSRAGKNTLTTPTTKEKKKIFFKKQETTTPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQVYYPLI

cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEccccHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHccccccEEEEEEEccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHcccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccc

********************************************NVAFAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENL**********************************MIIITRVTADISLAK*************************VQTEIERVYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKS*****TRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWRATH***************************************************************************************************FFKKQETTTPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVTADISLAK***********************TEVQTEIERVYELASTLQVYYPLI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Voltage-dependent L-type calcium channel subunit beta-3	The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.	confident	P54285
Voltage-dependent L-type calcium channel subunit beta-3	The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.	confident	P54284
Voltage-dependent L-type calcium channel subunit beta-3	The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.	confident	P54287

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005891 [CC]	voltage-gated calcium channel complex	probable	GO:0043234, GO:0032991, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0034704, GO:0071944, GO:0034702, GO:0034703, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0050852 [BP]	T cell receptor signaling pathway	probable	GO:0048584, GO:0048583, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0002764, GO:0002768, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0050851, GO:0002757, GO:0009987, GO:0050794, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002429, GO:0050896, GO:0050778, GO:0002376, GO:0002253, GO:0044763
GO:0005245 [MF]	voltage-gated calcium channel activity	probable	GO:0005261, GO:0005262, GO:0003674, GO:0015085, GO:0072509, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0022839, GO:0022838

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DEY, chain A
Confidence level:very confident
Coverage over the Query: 367-390,406-462,482-507
View the alignment between query and template
View the model in PyMOL

Template: 1T0J, chain B
Confidence level:very confident
Coverage over the Query: 147-162,173-295
View the alignment between query and template
View the model in PyMOL

Template: 4DEX, chain A
Confidence level:very confident
Coverage over the Query: 40-168,182-295
View the alignment between query and template
View the model in PyMOL