Psyllid ID: psy6613


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510
MVVGSAESNFSQPSSDLSLDEEKETLRREKERQALSQLEKARAKNVAFAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQTQARNPKLYSSKTSSTSNLGALSSDAPSPGMIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWRATHPPAAPPQPLTLLPPRQLTAHQSVVIPPSPSMGSAESNFSQPSSDLSLDEEKETLRREKERQALSQLEKARVTDDNESIGNSRAGKNTLTTPTTKEKKKIFFKKQETTTPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQVYYPLI
ccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccEEEEcccccEEEccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEccccHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHccccccEEEEEEEccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccEEEEccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHcccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHccccEEEEEEEccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccc
cccccccccccccccccccHHcHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccccccccccEEEEEcHHHHHHEEEccccccEEEHEEcccccEEEccccHHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEEccHHHHHHcccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHccEEEEcccccccHHHHHHcccccEEEEEEEccHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHcHEEEcHcHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHcccccccccccccccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEHHHHHHHHHHcccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcccc
mvvgsaesnfsqpssdlsldEEKETLRREKERQALSQLEKARAKNVAFAVRTNvkydgsidddspvhgyavSFDIHEFLHIkekydsnwwIGRLVKegsecgfipspvklENLRLQqtqarnpklyssktsstsnlgalssdapspgmIIITRVTADISLAKRslmsnpskraimersnsrssVLTEVQTEIERVYELASTLQLVVLDcdtinhpsqlaktnlspcivylkisSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWrathppaappqpltllpprqltahqsvvippspsmgsaesnfsqpssdlsldEEKETLRREKERQALSQLEKArvtddnesignsragkntlttpttkEKKKIFFKkqetttpydvvpsmrpvvlvgpslkgyevTDMMQKALFDFLKHRFEGRIIITRVTADISLAKRslmsnpskraimersnsrssVLTEVQTEIERVYELASTLQVYYPLI
mvvgsaesnfsqpssdlsldeEKETLRREKERQALSQlekaraknvafavRTNVkydgsidddspVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQTqarnpklyssktsstsnlgalssdapspgMIIITRVTADISLAKrslmsnpskraimersnsrssvLTEVQTEIERVYELASTLQLVVLDCDTINHPSqlaktnlspCIVYLKISSPKVLQRLIKSrgksqtrhLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWRATHPPAAPPQPLTLLPPRQLTAHQSVVIPPSPSMGSAESnfsqpssdlslDEEKETLRREKERqalsqlekarvtddnesignsragkntlttpttkekkkiffkkqetttpydvvpsmrpVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITrvtadislakrslmsnpskraimersnsrssvlTEVQTEIERVYELASTLQVYYPLI
MVVGSAESNFSQPSSDLSLDeeketlrrekerQALSQLEKARAKNVAFAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQTQARNPKLYSSKTSSTSNLGALSSDAPSPGMIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWrathppaappqpltllpprqltaHQSVVIPPSPSMGSAESNFSQPSSDLSLDeeketlrrekerQALSQLEKARVTDDNESIGNSRAGkntlttpttkekkkiffkkqetttPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQVYYPLI
********************************************NVAFAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKL*************************************MIIITRVTADIS**************************TEVQTEIERVYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKS*****TRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWR*****************************************************************************************************IFFKKQETTTPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVTADISLA**************************VQTEIERVYELASTLQVYYP**
**********************************************AFAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENL********************************************ISLAK******************************ERVYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQR****************MVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWRATH**************************************************************************************************************DVVPSMRPVVLVGPSLKG*EVTDMMQKALFDFLKHRFEGRIIITRVTADISLAK***********************TEVQTEIERVYELASTLQVYYPLI
******************************************AKNVAFAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQT********************LSSDAPSPGMIIITRVTADISLAKRSLMSNPSKRA**************VQTEIERVYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWRATHPPAAPPQPLTLLPPRQLTAHQSVVIPPS*************************************************IGNSRAGKNTLTTPTTKEKKKIFFKKQETTTPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVTADISLAKRSLMSNPSKRA**************VQTEIERVYELASTLQVYYPLI
*************************LRREKERQALSQLEKARAKNVAFAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQTQA***********************PSPGMIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWRATHPP*************************************************************************************************FFKKQETTTPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQVYYPLI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVGSAESNFSQPSSDLSLDEEKETLRREKERQALSQLEKARAKNVAFAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQTQARNPKLYSSKTSSTSNLGALSSDAPSPGMIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWRATHPPAAPPQPLTLLPPRQLTAHQSVVIPPSPSMGSAESNFSQPSSDLSLDEEKETLRREKERQALSQLEKARVTDDNESIGNSRAGKNTLTTPTTKEKKKIFFKKQETTTPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQVYYPLI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query510 2.2.26 [Sep-21-2011]
P54286477 Voltage-dependent L-type yes N/A 0.611 0.654 0.542 1e-102
P54284484 Voltage-dependent L-type yes N/A 0.611 0.644 0.542 1e-102
P54287484 Voltage-dependent L-type yes N/A 0.611 0.644 0.540 1e-101
P54285484 Voltage-dependent L-type yes N/A 0.611 0.644 0.540 1e-101
Q9MZL3484 Voltage-dependent L-type yes N/A 0.619 0.652 0.543 1e-100
Q08289660 Voltage-dependent L-type no N/A 0.315 0.243 0.791 2e-71
P54288632 Voltage-dependent L-type no N/A 0.411 0.332 0.637 3e-71
Q9MZL5603 Voltage-dependent L-type no N/A 0.315 0.266 0.791 4e-71
Q8CC27655 Voltage-dependent L-type no N/A 0.350 0.273 0.728 2e-70
Q8VGC3655 Voltage-dependent L-type no N/A 0.315 0.245 0.792 2e-70
>sp|P54286|CACB3_RABIT Voltage-dependent L-type calcium channel subunit beta-3 OS=Oryctolagus cuniculus GN=CACNB3 PE=2 SV=1 Back     alignment and function desciption
 Score =  372 bits (954), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 203/374 (54%), Positives = 252/374 (67%), Gaps = 62/374 (16%)

Query: 3   VGSAESNFSQPS--SDLSLDEEKETLRREKERQALSQLEKARAKNVAFAVRTNVKYDGSI 60
            GSA+S  S+PS  SD+SL+E++E+ RRE E QA  QLE+A+ K VAFAVRTNV Y G +
Sbjct: 15  AGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQQLERAKHKPVAFAVRTNVSYCGVL 74

Query: 61  DDDSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQTQ- 119
           D++ PV G  ++F+  +FLHIKEKY ++WWIGRLVKEG +  FIPSP +LE++RL+Q Q 
Sbjct: 75  DEECPVQGSGINFEAKDFLHIKEKYSNDWWIGRLVKEGGDIAFIPSPQRLESIRLKQEQK 134

Query: 120 ARNPKLYSSKTSSTSNLGALSSDAPS------------------PGM------------- 148
           AR     S   SS S++G   S  PS                  P M             
Sbjct: 135 ARR----SGNPSSLSDIGNRRSPPPSLAKQKQKQAEHVPPYDVVPSMRPVVLVGPSLKGY 190

Query: 149 ---------------------IIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTE 187
                                I ITRVTAD+SLAKRS+++NP KR I+ERS++RSS+  E
Sbjct: 191 EVTDMMQKALFDFLKHRFDGRISITRVTADLSLAKRSVLNNPGKRTIIERSSARSSI-AE 249

Query: 188 VQTEIERVYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGK 247
           VQ+EIER++ELA +LQLVVLD DTINHP+QLAKT+L+P IV++K+SSPKVLQRLI+SRGK
Sbjct: 250 VQSEIERIFELAKSLQLVVLDADTINHPAQLAKTSLAPIIVFVKVSSPKVLQRLIRSRGK 309

Query: 248 SQTRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWRATHPPAAPPQP 307
           SQ +HL VQM+A +KL QCP E FDVILDENQLEDACEH+AEYLE YWRATH PA  P P
Sbjct: 310 SQMKHLTVQMMAYDKLVQCPPESFDVILDENQLEDACEHLAEYLEVYWRATHHPA--PGP 367

Query: 308 LTLLPPRQLTAHQS 321
             L PP  +   QS
Sbjct: 368 GLLGPPSAIPGLQS 381




The beta subunit of voltage-dependent calcium channels contributes to the function of the calcium channel by increasing peak calcium current, shifting the voltage dependencies of activation and inactivation, modulating G protein inhibition and controlling the alpha-1 subunit membrane targeting.
Oryctolagus cuniculus (taxid: 9986)
>sp|P54284|CACB3_HUMAN Voltage-dependent L-type calcium channel subunit beta-3 OS=Homo sapiens GN=CACNB3 PE=1 SV=1 Back     alignment and function description
>sp|P54287|CACB3_RAT Voltage-dependent L-type calcium channel subunit beta-3 OS=Rattus norvegicus GN=Cacnb3 PE=1 SV=1 Back     alignment and function description
>sp|P54285|CACB3_MOUSE Voltage-dependent L-type calcium channel subunit beta-3 OS=Mus musculus GN=Cacnb3 PE=2 SV=2 Back     alignment and function description
>sp|Q9MZL3|CACB3_BOVIN Voltage-dependent L-type calcium channel subunit beta-3 OS=Bos taurus GN=CACNB3 PE=2 SV=2 Back     alignment and function description
>sp|Q08289|CACB2_HUMAN Voltage-dependent L-type calcium channel subunit beta-2 OS=Homo sapiens GN=CACNB2 PE=1 SV=3 Back     alignment and function description
>sp|P54288|CACB2_RABIT Voltage-dependent L-type calcium channel subunit beta-2 OS=Oryctolagus cuniculus GN=CACNB2 PE=1 SV=1 Back     alignment and function description
>sp|Q9MZL5|CACB2_BOVIN Voltage-dependent L-type calcium channel subunit beta-2 OS=Bos taurus GN=CACNB2 PE=2 SV=1 Back     alignment and function description
>sp|Q8CC27|CACB2_MOUSE Voltage-dependent L-type calcium channel subunit beta-2 OS=Mus musculus GN=Cacnb2 PE=2 SV=1 Back     alignment and function description
>sp|Q8VGC3|CACB2_RAT Voltage-dependent L-type calcium channel subunit beta-2 OS=Rattus norvegicus GN=Cacnb2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
348534909515 PREDICTED: voltage-dependent L-type calc 0.590 0.584 0.606 1e-109
390981011339 Chain A, Crystal Structure Of The Voltag 0.582 0.876 0.623 1e-109
390981014337 Chain A, Crystal Structure Of The Voltag 0.582 0.881 0.623 1e-109
395539976562 PREDICTED: voltage-dependent L-type calc 0.582 0.528 0.597 1e-108
119580962471 calcium channel, voltage-dependent, beta 0.596 0.645 0.583 1e-108
395539974 613 PREDICTED: voltage-dependent L-type calc 0.578 0.481 0.609 1e-108
49259232337 Chain A, Structural Analysis Of The Volt 0.582 0.881 0.620 1e-108
348521380390 PREDICTED: voltage-dependent L-type calc 0.6 0.784 0.550 1e-105
410899304390 PREDICTED: voltage-dependent L-type calc 0.6 0.784 0.544 1e-104
47228723370 unnamed protein product [Tetraodon nigro 0.6 0.827 0.542 1e-104
>gi|348534909|ref|XP_003454944.1| PREDICTED: voltage-dependent L-type calcium channel subunit beta-4-like isoform 2 [Oreochromis niloticus] Back     alignment and taxonomy information
 Score =  402 bits (1033), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 213/351 (60%), Positives = 257/351 (73%), Gaps = 50/351 (14%)

Query: 4   GSAESNFSQPS-SDLSLDEEKETLRREKERQALSQLEKARAKNVAFAVRTNVKYDGSIDD 62
           GSA+S  S+PS SD+SL+EEKE  R+E+E+QA  QLE+A+ K VAFAVRTNV Y G++D+
Sbjct: 50  GSADSYTSRPSDSDVSLEEEKEGGRQEREQQATVQLERAKTKAVAFAVRTNVSYCGALDE 109

Query: 63  DSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQTQARN 122
           D PV G AVSFD  +FLHIKEKY+++WWIGRLVKEG + GFIPSP+KLEN+RLQQ Q R 
Sbjct: 110 DVPVAGTAVSFDAKDFLHIKEKYNNDWWIGRLVKEGCDIGFIPSPLKLENIRLQQEQKRG 169

Query: 123 PKLYSSKTSSTSNLGALSSDA--------------------------PS----------- 145
                S  +S+S+LG + S                            PS           
Sbjct: 170 RFPGKSSGNSSSSLGEMVSSGKQKQKVAEHVPPYDVVPSMRPVVLVGPSLKGYEVTDMMQ 229

Query: 146 -----------PGMIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIER 194
                       G I ITRVTADISLAKRS+++NPSKRAI+ERSN+RSS L EVQ+EIER
Sbjct: 230 KALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNTRSS-LAEVQSEIER 288

Query: 195 VYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLN 254
           ++ELA +LQLVVLD DTINHP+QL KT+L+P IV++K+SSPKVLQRLIKSRGKSQ++HLN
Sbjct: 289 IFELARSLQLVVLDADTINHPAQLIKTSLAPIIVHVKVSSPKVLQRLIKSRGKSQSKHLN 348

Query: 255 VQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWRATHPPAAPP 305
           VQ+VAAEKLAQCP EMFD+ILDENQLEDACEH+AEYLEAYWRATH   + P
Sbjct: 349 VQLVAAEKLAQCPSEMFDIILDENQLEDACEHLAEYLEAYWRATHTSLSMP 399




Source: Oreochromis niloticus

Species: Oreochromis niloticus

Genus: Oreochromis

Family: Cichlidae

Order: Perciformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|390981011|pdb|4DEX|A Chain A, Crystal Structure Of The Voltage Dependent Calcium Channel Beta-2 Subunit In Complex With The Cav2.2 I-Ii Linker Back     alignment and taxonomy information
>gi|390981014|pdb|4DEY|A Chain A, Crystal Structure Of The Voltage Dependent Calcium Channel Beta-2 Subunit In Complex With The Cav1.2 I-Ii Linker Back     alignment and taxonomy information
>gi|395539976|ref|XP_003771938.1| PREDICTED: voltage-dependent L-type calcium channel subunit beta-2 isoform 2 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|119580962|gb|EAW60558.1| calcium channel, voltage-dependent, beta 1 subunit, isoform CRA_c [Homo sapiens] Back     alignment and taxonomy information
>gi|395539974|ref|XP_003771937.1| PREDICTED: voltage-dependent L-type calcium channel subunit beta-2 isoform 1 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|49259232|pdb|1T3L|A Chain A, Structural Analysis Of The Voltage-Dependent Calcium Channel Beta Subunit Functional Core In Complex With Alpha1 Interaction Domain gi|49259234|pdb|1T3S|A Chain A, Structural Analysis Of The Voltage-Dependent Calcium Channel Beta Subunit Functional Core Back     alignment and taxonomy information
>gi|348521380|ref|XP_003448204.1| PREDICTED: voltage-dependent L-type calcium channel subunit beta-4-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|410899304|ref|XP_003963137.1| PREDICTED: voltage-dependent L-type calcium channel subunit beta-4-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|47228723|emb|CAG07455.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query510
FB|FBgn0259822 817 Ca-beta "Ca2+-channel-protein- 0.292 0.182 0.832 2.4e-108
UNIPROTKB|F1NX50420 CACNB2 "Uncharacterized protei 0.290 0.352 0.818 7.6e-99
ZFIN|ZDB-GENE-080320-2519 cacnb4a "calcium channel, volt 0.290 0.285 0.785 6e-97
UNIPROTKB|F1NQG2472 CACNB4 "Uncharacterized protei 0.290 0.313 0.805 1.3e-96
UNIPROTKB|F1NQG4386 CACNB4 "Uncharacterized protei 0.290 0.383 0.805 1.3e-96
UNIPROTKB|E7EN11473 CACNB4 "Voltage-dependent L-ty 0.290 0.312 0.798 2.6e-96
UNIPROTKB|F1N167520 CACNB4 "Uncharacterized protei 0.290 0.284 0.798 3.3e-96
UNIPROTKB|F1PNU9472 CACNB4 "Uncharacterized protei 0.290 0.313 0.798 3.3e-96
UNIPROTKB|F8WA06487 CACNB4 "Voltage-dependent L-ty 0.290 0.303 0.798 3.3e-96
UNIPROTKB|H0Y476515 CACNB4 "Voltage-dependent L-ty 0.290 0.287 0.798 3.3e-96
FB|FBgn0259822 Ca-beta "Ca2+-channel-protein-beta-subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 622 (224.0 bits), Expect = 2.4e-108, Sum P(2) = 2.4e-108
 Identities = 124/149 (83%), Positives = 137/149 (91%)

Query:   147 GMIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQLVV 206
             G IIITRV ADISLAKRS+M+NPSKRAIMERS+SRS  L +VQ EIER++ELA +LQLVV
Sbjct:   241 GRIIITRVMADISLAKRSIMNNPSKRAIMERSSSRSDCLGKVQEEIERIFELARSLQLVV 300

Query:   207 LDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQC 266
             LDCDTINHPSQLAKT+L+P IVYLKISS KVLQRLIKSRGKSQ ++L+VQMVAAEKLAQC
Sbjct:   301 LDCDTINHPSQLAKTSLAPTIVYLKISSSKVLQRLIKSRGKSQAKNLSVQMVAAEKLAQC 360

Query:   267 PQEMFDVILDENQLEDACEHIAEYLEAYW 295
             P +MFDVILDENQLEDACEHIAEYLE YW
Sbjct:   361 PPDMFDVILDENQLEDACEHIAEYLETYW 389


GO:0005886 "plasma membrane" evidence=ISS;NAS
GO:0005245 "voltage-gated calcium channel activity" evidence=ISS;NAS
GO:0005891 "voltage-gated calcium channel complex" evidence=ISS;NAS
GO:0006816 "calcium ion transport" evidence=ISS
GO:0070588 "calcium ion transmembrane transport" evidence=IEA
UNIPROTKB|F1NX50 CACNB2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080320-2 cacnb4a "calcium channel, voltage-dependent, beta 4a subunit" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQG2 CACNB4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQG4 CACNB4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E7EN11 CACNB4 "Voltage-dependent L-type calcium channel subunit beta-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N167 CACNB4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PNU9 CACNB4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F8WA06 CACNB4 "Voltage-dependent L-type calcium channel subunit beta-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y476 CACNB4 "Voltage-dependent L-type calcium channel subunit beta-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P54285CACB3_MOUSENo assigned EC number0.54010.61170.6446yesN/A
P54284CACB3_HUMANNo assigned EC number0.54270.61170.6446yesN/A
P54287CACB3_RATNo assigned EC number0.54010.61170.6446yesN/A
P54286CACB3_RABITNo assigned EC number0.54270.61170.6540yesN/A
Q9MZL3CACB3_BOVINNo assigned EC number0.54320.61960.6528yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
cd1186362 cd11863, SH3_CACNB, Src Homology 3 domain of Volta 5e-39
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 6e-38
cd1204368 cd12043, SH3_CACNB4, Src Homology 3 domain of Volt 8e-31
cd1204168 cd12041, SH3_CACNB1, Src Homology 3 domain of Volt 1e-29
cd1204069 cd12040, SH3_CACNB2, Src Homology 3 domain of Volt 7e-29
cd1204268 cd12042, SH3_CACNB3, Src Homology 3 domain of Volt 6e-27
smart00072174 smart00072, GuKc, Guanylate kinase homologues 1e-22
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 1e-15
pfam1205242 pfam12052, VGCC_beta4Aa_N, Voltage gated calcium c 5e-12
pfam1205242 pfam12052, VGCC_beta4Aa_N, Voltage gated calcium c 1e-11
cd1203562 cd12035, SH3_MPP1-like, Src Homology 3 domain of M 2e-07
cd1208162 cd12081, SH3_CASK, Src Homology 3 domain of Calciu 1e-06
cd1208062 cd12080, SH3_MPP1, Src Homology 3 domain of Membra 2e-06
cd1203861 cd12038, SH3_MPP6, Src Homology 3 domain of Membra 5e-06
cd1186161 cd11861, SH3_DLG-like, Src Homology 3 domain of Di 1e-05
smart0032656 smart00326, SH3, Src homology 3 domains 1e-05
cd1203066 cd12030, SH3_DLG4, Src Homology 3 domain of Disks 3e-05
cd1186261 cd11862, SH3_MPP, Src Homology 3 domain of Membran 3e-05
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 3e-04
cd1203663 cd12036, SH3_MPP5, Src Homology 3 domain of Membra 6e-04
cd1203759 cd12037, SH3_MPP2, Src Homology 3 domain of Membra 8e-04
cd1202967 cd12029, SH3_DLG3, Src Homology 3 domain of Disks 0.001
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 0.001
cd1203167 cd12031, SH3_DLG1, Src Homology 3 domain of Disks 0.004
>gnl|CDD|212797 cd11863, SH3_CACNB, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta Back     alignment and domain information
 Score =  135 bits (342), Expect = 5e-39
 Identities = 48/62 (77%), Positives = 55/62 (88%)

Query: 48  FAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSP 107
           FAVRTNV YDGS+DDDSPV GYAVSF+  +FLHIKEKY+++WWIGRLVKEG + GFIPSP
Sbjct: 1   FAVRTNVGYDGSLDDDSPVPGYAVSFEAKDFLHIKEKYNNDWWIGRLVKEGCDIGFIPSP 60

Query: 108 VK 109
            K
Sbjct: 61  AK 62


Voltage-dependent calcium channels (Ca(V)s) are multi-protein complexes that regulate the entry of calcium into cells. They impact muscle contraction, neuronal migration, hormone and neurotransmitter release, and the activation of calcium-dependent signaling pathways. They are composed of four subunits: alpha1, alpha2delta, beta, and gamma. The beta subunit is a soluble and intracellular protein that interacts with the transmembrane alpha1 subunit. It facilitates the trafficking and proper localization of the alpha1 subunit to the cellular plasma membrane. Vertebrates contain four different beta subunits from distinct genes (beta1-4); each exists as multiple splice variants. All are expressed in the brain while other tissues show more specific expression patterns. The beta subunits show similarity to MAGUK (membrane-associated guanylate kinase) proteins in that they contain SH3 and inactive guanylate kinase (GuK) domains; however, they do not appear to contain a PDZ domain. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 62

>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|212976 cd12043, SH3_CACNB4, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta4 Back     alignment and domain information
>gnl|CDD|212974 cd12041, SH3_CACNB1, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta-1 Back     alignment and domain information
>gnl|CDD|212973 cd12040, SH3_CACNB2, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta2 Back     alignment and domain information
>gnl|CDD|212975 cd12042, SH3_CACNB3, Src Homology 3 domain of Voltage-dependent L-type calcium channel subunit beta3 Back     alignment and domain information
>gnl|CDD|214504 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|204819 pfam12052, VGCC_beta4Aa_N, Voltage gated calcium channel subunit beta domain 4Aa N terminal Back     alignment and domain information
>gnl|CDD|204819 pfam12052, VGCC_beta4Aa_N, Voltage gated calcium channel subunit beta domain 4Aa N terminal Back     alignment and domain information
>gnl|CDD|212968 cd12035, SH3_MPP1-like, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1)-like proteins Back     alignment and domain information
>gnl|CDD|213014 cd12081, SH3_CASK, Src Homology 3 domain of Calcium/calmodulin-dependent Serine protein Kinase Back     alignment and domain information
>gnl|CDD|213013 cd12080, SH3_MPP1, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1) Back     alignment and domain information
>gnl|CDD|212971 cd12038, SH3_MPP6, Src Homology 3 domain of Membrane Protein, Palmitoylated 6 (or MAGUK p55 subfamily member 6) Back     alignment and domain information
>gnl|CDD|212795 cd11861, SH3_DLG-like, Src Homology 3 domain of Disks large homolog proteins Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212963 cd12030, SH3_DLG4, Src Homology 3 domain of Disks Large homolog 4 Back     alignment and domain information
>gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein, Palmitoylated (or MAGUK p55 subfamily member) proteins Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein, Palmitoylated 5 (or MAGUK p55 subfamily member 5) Back     alignment and domain information
>gnl|CDD|212970 cd12037, SH3_MPP2, Src Homology 3 domain of Membrane Protein, Palmitoylated 2 (or MAGUK p55 subfamily member 2) Back     alignment and domain information
>gnl|CDD|212962 cd12029, SH3_DLG3, Src Homology 3 domain of Disks Large homolog 3 Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212964 cd12031, SH3_DLG1, Src Homology 3 domain of Disks Large homolog 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 510
KOG3812|consensus 475 100.0
KOG0609|consensus542 100.0
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 99.97
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 99.96
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 99.95
PRK14737186 gmk guanylate kinase; Provisional 99.95
PLN02772398 guanylate kinase 99.94
KOG0708|consensus359 99.94
KOG0707|consensus231 99.88
KOG3812|consensus475 99.88
PRK14738206 gmk guanylate kinase; Provisional 99.86
KOG3580|consensus1027 99.84
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.83
PRK00300205 gmk guanylate kinase; Provisional 99.79
PF1205242 VGCC_beta4Aa_N: Voltage gated calcium channel subu 99.7
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 99.67
PF1205242 VGCC_beta4Aa_N: Voltage gated calcium channel subu 99.43
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 99.34
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 99.27
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.1
PRK04040188 adenylate kinase; Provisional 99.03
PRK08356195 hypothetical protein; Provisional 98.96
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 98.93
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 98.9
KOG2199|consensus462 98.84
KOG4792|consensus293 98.77
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 98.71
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 98.67
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 98.64
COG3709192 Uncharacterized component of phosphonate metabolis 98.56
KOG1029|consensus1118 98.43
KOG1118|consensus366 98.42
KOG2070|consensus 661 98.39
PRK00698205 tmk thymidylate kinase; Validated 98.13
KOG4226|consensus379 98.13
PRK14731208 coaE dephospho-CoA kinase; Provisional 97.85
PRK12339197 2-phosphoglycerate kinase; Provisional 97.77
PRK00081194 coaE dephospho-CoA kinase; Reviewed 97.75
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 97.75
KOG3601|consensus222 97.74
KOG0162|consensus1106 97.73
PRK14732196 coaE dephospho-CoA kinase; Provisional 97.66
KOG2856|consensus472 97.62
PRK00131175 aroK shikimate kinase; Reviewed 97.62
PRK04182180 cytidylate kinase; Provisional 97.59
KOG4348|consensus627 97.59
PRK06762166 hypothetical protein; Provisional 97.58
PRK01184184 hypothetical protein; Provisional 97.56
KOG3875|consensus362 97.55
KOG4225|consensus489 97.53
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.48
PRK13975196 thymidylate kinase; Provisional 97.45
PRK03839180 putative kinase; Provisional 97.44
PRK14532188 adenylate kinase; Provisional 97.4
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 97.37
PRK14530215 adenylate kinase; Provisional 97.33
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 97.33
PRK14531183 adenylate kinase; Provisional 97.33
KOG2996|consensus865 97.33
TIGR02173171 cyt_kin_arch cytidylate kinase, putative. Proteins 97.29
KOG4348|consensus627 97.26
KOG0515|consensus752 97.26
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 97.25
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 97.25
PHA02530300 pseT polynucleotide kinase; Provisional 97.2
PTZ00451244 dephospho-CoA kinase; Provisional 97.17
PRK08233182 hypothetical protein; Provisional 97.16
PRK00279215 adk adenylate kinase; Reviewed 97.15
KOG3655|consensus484 97.14
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.14
PRK13808333 adenylate kinase; Provisional 97.13
PRK05480209 uridine/cytidine kinase; Provisional 97.13
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.1
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.09
TIGR00152188 dephospho-CoA kinase. This model produces scores i 97.08
KOG4226|consensus379 97.04
KOG4225|consensus489 97.01
PRK14734200 coaE dephospho-CoA kinase; Provisional 97.01
TIGR00235207 udk uridine kinase. Model contains a number of lon 96.96
PLN02422232 dephospho-CoA kinase 96.96
KOG1264|consensus1267 96.92
PRK05541176 adenylylsulfate kinase; Provisional 96.91
KOG2546|consensus483 96.9
PLN02200234 adenylate kinase family protein 96.9
PRK13946184 shikimate kinase; Provisional 96.89
PRK14730195 coaE dephospho-CoA kinase; Provisional 96.84
PRK08154309 anaerobic benzoate catabolism transcriptional regu 96.79
PRK14527191 adenylate kinase; Provisional 96.78
PRK13947171 shikimate kinase; Provisional 96.76
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 96.73
PRK05057172 aroK shikimate kinase I; Reviewed 96.72
KOG3632|consensus1335 96.52
KOG4575|consensus 874 96.52
KOG1029|consensus1118 96.5
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 96.46
PRK13974212 thymidylate kinase; Provisional 96.45
KOG0197|consensus468 96.42
PRK14526211 adenylate kinase; Provisional 96.35
PRK02496184 adk adenylate kinase; Provisional 96.34
KOG1843|consensus473 96.32
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 96.32
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 96.31
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 96.31
PRK14733204 coaE dephospho-CoA kinase; Provisional 96.3
PRK13973213 thymidylate kinase; Provisional 96.28
PRK13976209 thymidylate kinase; Provisional 96.2
PRK13949169 shikimate kinase; Provisional 96.19
PLN02842505 nucleotide kinase 96.15
PRK13948182 shikimate kinase; Provisional 96.12
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 96.03
PLN02459261 probable adenylate kinase 95.98
PRK12338319 hypothetical protein; Provisional 95.97
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyze 95.94
PF07931174 CPT: Chloramphenicol phosphotransferase-like prote 95.93
PRK06696223 uridine kinase; Validated 95.9
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 95.87
PLN02674244 adenylate kinase 95.74
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 95.68
PRK00889175 adenylylsulfate kinase; Provisional 95.54
PRK08118167 topology modulation protein; Reviewed 95.47
PRK12337475 2-phosphoglycerate kinase; Provisional 95.46
PRK07261171 topology modulation protein; Provisional 95.44
PRK09825176 idnK D-gluconate kinase; Provisional 95.41
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 95.34
PRK00625173 shikimate kinase; Provisional 95.3
PRK04220301 2-phosphoglycerate kinase; Provisional 95.25
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 95.23
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 95.14
KOG4278|consensus 1157 95.12
PTZ00088229 adenylate kinase 1; Provisional 95.12
PRK06217183 hypothetical protein; Validated 95.05
PF02223186 Thymidylate_kin: Thymidylate kinase; InterPro: IPR 95.02
KOG3771|consensus460 95.0
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 94.95
PRK14529223 adenylate kinase; Provisional 94.9
PLN02924220 thymidylate kinase 94.87
PRK03846198 adenylylsulfate kinase; Provisional 94.72
COG0703172 AroK Shikimate kinase [Amino acid transport and me 94.69
KOG1702|consensus264 94.57
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 94.55
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 94.53
PRK14528186 adenylate kinase; Provisional 94.52
PRK11545163 gntK gluconate kinase 1; Provisional 94.42
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transpo 94.38
PRK09270229 nucleoside triphosphate hydrolase domain-containin 94.15
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and me 94.04
COG4639168 Predicted kinase [General function prediction only 94.02
COG1428216 Deoxynucleoside kinases [Nucleotide transport and 93.87
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 93.79
PHA00729226 NTP-binding motif containing protein 93.75
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 93.72
KOG3347|consensus176 93.51
COG0645170 Predicted kinase [General function prediction only 93.36
KOG3557|consensus721 93.32
PRK03333395 coaE dephospho-CoA kinase/protein folding accessor 93.25
KOG3354|consensus191 93.24
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO 93.23
PF01121180 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 Th 93.2
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and m 93.19
PRK07933213 thymidylate kinase; Validated 93.12
PRK03731171 aroL shikimate kinase II; Reviewed 93.03
PRK14021 542 bifunctional shikimate kinase/3-dehydroquinate syn 92.72
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 92.56
KOG3079|consensus195 92.45
PRK00023225 cmk cytidylate kinase; Provisional 92.41
KOG2222|consensus848 92.4
COG1618179 Predicted nucleotide kinase [Nucleotide transport 92.28
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 92.24
PRK12288347 GTPase RsgA; Reviewed 92.18
PRK00098298 GTPase RsgA; Reviewed 92.06
PRK08099399 bifunctional DNA-binding transcriptional repressor 92.05
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 91.99
cd01128249 rho_factor Transcription termination factor rho is 91.69
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 91.63
PRK06620214 hypothetical protein; Validated 91.39
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 91.38
PF00004132 AAA: ATPase family associated with various cellula 91.33
PRK12289352 GTPase RsgA; Reviewed 91.24
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 91.23
COG0572218 Udk Uridine kinase [Nucleotide transport and metab 91.17
KOG4773|consensus386 91.09
PLN02199303 shikimate kinase 91.02
KOG3601|consensus222 91.02
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 90.97
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport 90.9
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 90.9
TIGR00436270 era GTP-binding protein Era. Era is an essential G 90.8
PLN02840421 tRNA dimethylallyltransferase 90.78
PLN02165334 adenylate isopentenyltransferase 90.74
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 90.55
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 90.39
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 90.34
TIGR00017217 cmk cytidylate kinase. This family consists of cyt 90.01
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 89.92
PRK13342413 recombination factor protein RarA; Reviewed 89.54
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate syn 89.51
KOG3632|consensus1335 89.44
COG1162301 Predicted GTPases [General function prediction onl 89.17
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 89.12
PRK05506632 bifunctional sulfate adenylyltransferase subunit 1 88.95
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 88.84
PRK09087226 hypothetical protein; Validated 88.77
PLN02318 656 phosphoribulokinase/uridine kinase 88.76
smart00382148 AAA ATPases associated with a variety of cellular 88.72
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 88.72
PRK07429327 phosphoribulokinase; Provisional 88.63
COG3265161 GntK Gluconate kinase [Carbohydrate transport and 88.48
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 88.12
KOG2996|consensus865 88.11
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 87.98
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 87.71
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 87.65
cd00876160 Ras Ras family. The Ras family of the Ras superfam 87.55
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 87.45
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 87.44
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 87.42
PF08303168 tRNA_lig_kinase: tRNA ligase kinase domain; InterP 87.42
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 87.26
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 87.21
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 87.17
PRK12608380 transcription termination factor Rho; Provisional 86.79
cd01881176 Obg_like The Obg-like subfamily consists of five w 86.69
PRK00089292 era GTPase Era; Reviewed 86.54
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 86.47
KOG1191|consensus531 86.31
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 86.17
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Pr 86.05
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 85.78
COG2256436 MGS1 ATPase related to the helicase subunit of the 85.58
COG1100219 GTPase SAR1 and related small G proteins [General 85.54
PF1355562 AAA_29: P-loop containing region of AAA domain 85.54
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 85.09
COG3172187 NadR Predicted ATPase/kinase involved in NAD metab 84.96
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 84.95
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 84.83
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 84.74
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 84.63
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 84.58
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 84.54
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 84.48
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 84.44
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 84.4
cd03115173 SRP The signal recognition particle (SRP) mediates 84.36
COG4185187 Uncharacterized protein conserved in bacteria [Fun 84.34
COG1126240 GlnQ ABC-type polar amino acid transport system, A 84.31
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 84.24
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide- 84.23
PRK06761282 hypothetical protein; Provisional 83.98
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 83.84
PF00485194 PRK: Phosphoribulokinase / Uridine kinase family; 83.84
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 83.83
PRK13849231 putative crown gall tumor protein VirC1; Provision 83.7
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 83.68
KOG3523|consensus695 83.67
COG3842352 PotA ABC-type spermidine/putrescine transport syst 83.66
PRK12678672 transcription termination factor Rho; Provisional 83.57
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 83.56
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 83.33
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 83.31
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 83.24
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 83.2
COG2884223 FtsE Predicted ATPase involved in cell division [C 83.18
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 83.17
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 83.13
PRK04195482 replication factor C large subunit; Provisional 83.08
PF00005137 ABC_tran: ABC transporter This structure is on hol 82.93
COG4619223 ABC-type uncharacterized transport system, ATPase 82.93
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 82.87
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 82.86
cd00154159 Rab Rab family. Rab GTPases form the largest famil 82.84
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 82.83
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 82.7
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 82.69
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 82.67
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 82.66
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 82.64
cd04123162 Rab21 Rab21 subfamily. The localization and functi 82.59
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 82.52
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 82.49
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 82.48
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 82.47
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 82.35
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 82.26
COG1117253 PstB ABC-type phosphate transport system, ATPase c 82.11
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 81.99
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 81.97
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 81.94
PF1130275 DUF3104: Protein of unknown function (DUF3104); In 81.72
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 81.72
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 81.69
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 81.62
COG1136226 SalX ABC-type antimicrobial peptide transport syst 81.35
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 81.24
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and me 81.21
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 81.15
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 81.14
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 81.12
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 81.08
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 81.08
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 81.05
PF01202158 SKI: Shikimate kinase; InterPro: IPR000623 Shikima 81.04
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 81.03
TIGR00767415 rho transcription termination factor Rho. Members 81.02
TIGR00231161 small_GTP small GTP-binding protein domain. This m 80.9
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 80.85
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 80.8
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 80.76
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 80.7
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 80.68
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 80.65
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 80.65
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 80.61
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 80.58
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 80.52
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 80.46
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 80.45
KOG3220|consensus225 80.34
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 80.27
PRK12298390 obgE GTPase CgtA; Reviewed 80.24
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 80.23
KOG0738|consensus491 80.21
COG3638258 ABC-type phosphate/phosphonate transport system, A 80.18
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 80.17
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 80.04
PTZ00301210 uridine kinase; Provisional 80.02
>KOG3812|consensus Back     alignment and domain information
Probab=100.00  E-value=6.5e-77  Score=598.25  Aligned_cols=252  Identities=70%  Similarity=1.048  Sum_probs=220.6

Q ss_pred             cCCCCCCCcCC--CCccchhhhHHHhHHHHHHHHHHHhhhccCCCeeEEEEeeccCCCCCCCCCCCCccccccCCceEEE
Q psy6613           4 GSAESNFSQPS--SDLSLDEEKETLRREKERQALSQLEKARAKNVAFAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHI   81 (510)
Q Consensus         4 ~~~~~~~~~~~--~d~~~~~~~~~~~~~~~~~a~~~L~~a~~k~~~~~VRAlfdY~~~~D~~iPc~e~~LsF~~GDiL~V   81 (510)
                      ||||||||||+  +|++||+|+|.+|+++|+||+.|||+|+.||++|.|||+.+|+|.-|+++|+++.+++|+..|+|||
T Consensus        13 ~sads~tS~pp~~sdv~leedre~~r~e~e~qA~~qLe~aK~KpVAFAV~tnv~Y~gslde~~Pv~g~aisF~~kDFlHI   92 (475)
T KOG3812|consen   13 GSADSYTSRPPSDSDVSLEEDREARRREAERQALRQLERAKRKPVAFAVRTNVSYDGSLDEDSPVQGHAISFEAKDFLHI   92 (475)
T ss_pred             ccccccccCCchhhhhhhhhhHHHHHHHHHHHHHHHHHhcccCCceEEEEeccccCCccCCCCCCCCceeeeccccceee
Confidence            79999999995  9999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EeecCCCceEEEEccCCCceeeecChhHHHHHHHHhhhccCCCcccccCCCCCCCCCCCCCCCCCCCeEEecCcCChHHH
Q psy6613          82 KEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQTQARNPKLYSSKTSSTSNLGALSSDAPSPGMIIITRVTADISLA  161 (510)
Q Consensus        82 ~~~~d~~WWqar~v~~~~~~GlIPS~~~~Errr~~~~~kk~~~l~~sk~~s~~~~~~~~~d~Ps~~RpI~GPsGvGKsTL  161 (510)
                      .++++++||+||.|.++++.|||||+.++|..+++++++       ++++  .|.        +   . +|+.|      
T Consensus        93 keKynnDWWIGRlVkeg~e~gFiPsp~rLen~r~~~e~~-------~~~~--~n~--------s---s-l~~vg------  145 (475)
T KOG3812|consen   93 KEKYNNDWWIGRLVKEGCEIGFIPSPVRLENIRLQQEQS-------SKSS--GNS--------S---S-LGDVG------  145 (475)
T ss_pred             hhhcccchhHHHHhhcCCccccccchHHHHHHHhhhhhh-------cccC--CCc--------c---c-cCCcc------
Confidence            999999999999999999999999999999999887761       1110  000        0   0 01111      


Q ss_pred             HHHHhcCCCCceeeecCCCchhhhhhhcccHHHHHHHHHcCCeEEEEeccCCchhHhhhcCCCceEEEEeCCCHHHHHHH
Q psy6613         162 KRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQLVVLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRL  241 (510)
Q Consensus       162 ~~rLL~~P~~F~~sVshTTR~pFe~~I~TslesI~~vi~sGKi~ILDID~qg~~lq~lks~l~PivIFIkPPS~e~L~~r  241 (510)
                                        ||                                                            
T Consensus       146 ------------------~r------------------------------------------------------------  147 (475)
T KOG3812|consen  146 ------------------SR------------------------------------------------------------  147 (475)
T ss_pred             ------------------cC------------------------------------------------------------
Confidence                              11                                                            


Q ss_pred             HHhcCCCcHHHHHHHHHHHHHHHhcCCCCccEEEeCCCHHHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCCcccccCCcc
Q psy6613         242 IKSRGKSQTRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEYLEAYWRATHPPAAPPQPLTLLPPRQLTAHQS  321 (510)
Q Consensus       242 Lr~Rgt~~~e~i~kRL~aa~eLEq~~~~~FD~VIvNDdLd~A~~eL~~ileai~~a~h~p~~~p~~~~~~~~~~~~~~~~  321 (510)
                                                                                                      
T Consensus       148 --------------------------------------------------------------------------------  147 (475)
T KOG3812|consen  148 --------------------------------------------------------------------------------  147 (475)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cccCCCCCCCCcccCCCCCCCCCChhHhHHHHHHHHHHHHHHHHHHhccCCCCCCCccccCCCCccCCCChhhhhhhccc
Q psy6613         322 VVIPPSPSMGSAESNFSQPSSDLSLDEEKETLRREKERQALSQLEKARVTDDNESIGNSRAGKNTLTTPTTKEKKKIFFK  401 (510)
Q Consensus       322 ~~~~~s~~~~s~~s~~s~ps~~~s~~~~~~~~~~~~e~~a~~~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  401 (510)
                                                                                       .+||++..+.|.- -
T Consensus       148 -----------------------------------------------------------------~stpp~ta~~kd~-~  161 (475)
T KOG3812|consen  148 -----------------------------------------------------------------RSTPPSTADQKDK-S  161 (475)
T ss_pred             -----------------------------------------------------------------CCCCCChhhhhhh-h
Confidence                                                                             0122222222210 1


Q ss_pred             ccCCCCCccccCCCcceEEeCCCCCCchhHHHHHHHHHHHHhhhcCCcEEEEEEecchhhHHhhccCCccccccccccCC
Q psy6613         402 KQETTTPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVTADISLAKRSLMSNPSKRAIMERSNS  481 (510)
Q Consensus       402 ~~~~~~~y~~~p~~rp~~~~gp~~~~~~~~~~m~~al~~~l~~~f~~~i~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~  481 (510)
                      ++|++||||||||||||||||||||||||||||||||||||||||+|||+||||||||||||||++|||+|++||||+|+
T Consensus       162 ~~E~~pPYdVVPSmRPvVLvGPsLkgyevTdmmqkAlfd~lkhrF~grisitrVtaDIslakrS~lnnp~k~~~~eRsn~  241 (475)
T KOG3812|consen  162 ITEHVPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFDGRISITRVTADISLAKRSVLNNPSKRAIIERSNT  241 (475)
T ss_pred             hcccCCccccCCCCCceEEecCccccccHHHHHHHHHHHHHHHhcCCceeEEEEeechhhhhhhhccCccceeeeeeccc
Confidence            38999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcchhHHHHHHHHHHHHHhhcccccc
Q psy6613         482 RSSVLTEVQTEIERVYELASTLQVYY  507 (510)
Q Consensus       482 ~~~~~~~~~~e~~~i~~~~~~~~l~~  507 (510)
                      |+| +||||+||||||||||+||||+
T Consensus       242 Rss-laevqsEiErIfelarsLqLvv  266 (475)
T KOG3812|consen  242 RSS-LAEVQSEIERIFELARSLQLVV  266 (475)
T ss_pred             hhh-HHHHHHHHHHHHHHHhhceEEE
Confidence            988 9999999999999999999986



>KOG0609|consensus Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>KOG0707|consensus Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF12052 VGCC_beta4Aa_N: Voltage gated calcium channel subunit beta domain 4Aa N terminal; InterPro: IPR000584 Ca2+ ions are unique in that they not only carry charge but they are also the most widely used of diffusible second messengers Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PF12052 VGCC_beta4Aa_N: Voltage gated calcium channel subunit beta domain 4Aa N terminal; InterPro: IPR000584 Ca2+ ions are unique in that they not only carry charge but they are also the most widely used of diffusible second messengers Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK12339 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>PRK14732 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>PRK13975 thymidylate kinase; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK13808 adenylate kinase; Provisional Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR00152 dephospho-CoA kinase Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>PRK14734 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>PLN02422 dephospho-CoA kinase Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK13946 shikimate kinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>PRK13947 shikimate kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK05057 aroK shikimate kinase I; Reviewed Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK13974 thymidylate kinase; Provisional Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK14733 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>PRK13976 thymidylate kinase; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PLN02842 nucleotide kinase Back     alignment and domain information
>PRK13948 shikimate kinase; Provisional Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PLN02459 probable adenylate kinase Back     alignment and domain information
>PRK12338 hypothetical protein; Provisional Back     alignment and domain information
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor Back     alignment and domain information
>PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK12337 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>PRK00625 shikimate kinase; Provisional Back     alignment and domain information
>PRK04220 2-phosphoglycerate kinase; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>PRK14529 adenylate kinase; Provisional Back     alignment and domain information
>PLN02924 thymidylate kinase Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>PRK11545 gntK gluconate kinase 1; Provisional Back     alignment and domain information
>COG2019 AdkA Archaeal adenylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4639 Predicted kinase [General function prediction only] Back     alignment and domain information
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>KOG3347|consensus Back     alignment and domain information
>COG0645 Predicted kinase [General function prediction only] Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/protein folding accessory domain-containing protein; Provisional Back     alignment and domain information
>KOG3354|consensus Back     alignment and domain information
>cd02030 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) is a family of proteins that are highly similar to deoxyribonucleoside kinases (dNK) Back     alignment and domain information
>PF01121 CoaE: Dephospho-CoA kinase; InterPro: IPR001977 This family contains dephospho-CoA kinases (2 Back     alignment and domain information
>COG0125 Tmk Thymidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK07933 thymidylate kinase; Validated Back     alignment and domain information
>PRK03731 aroL shikimate kinase II; Reviewed Back     alignment and domain information
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>KOG3079|consensus Back     alignment and domain information
>PRK00023 cmk cytidylate kinase; Provisional Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>PLN02199 shikimate kinase Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>PLN02165 adenylate isopentenyltransferase Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>TIGR00017 cmk cytidylate kinase Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK13951 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>PLN02318 phosphoribulokinase/uridine kinase Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>PF08303 tRNA_lig_kinase: tRNA ligase kinase domain; InterPro: IPR015966 This entry represents a kinase domain found in fungal tRNA ligases [] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1191|consensus Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>COG4185 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12678 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>PF11302 DUF3104: Protein of unknown function (DUF3104); InterPro: IPR021453 This family of proteins with unknown function appears to be restricted to Cyanobacteria Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>PF01202 SKI: Shikimate kinase; InterPro: IPR000623 Shikimate kinase (2 Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>KOG3220|consensus Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
4dey_A337 Crystal Structure Of The Voltage Dependent Calcium 1e-102
4dey_A 337 Crystal Structure Of The Voltage Dependent Calcium 1e-43
4dex_A339 Crystal Structure Of The Voltage Dependent Calcium 1e-102
4dex_A 339 Crystal Structure Of The Voltage Dependent Calcium 1e-43
1t3l_A337 Structural Analysis Of The Voltage-Dependent Calciu 1e-101
1t3l_A 337 Structural Analysis Of The Voltage-Dependent Calciu 1e-43
1vyt_A351 Beta3 Subunit Complexed With Aid Length = 351 2e-91
1vyt_A351 Beta3 Subunit Complexed With Aid Length = 351 4e-41
1vyu_A351 Beta3 Subunit Of Voltage-Gated Ca2+-Channel Length 1e-90
1vyu_A351 Beta3 Subunit Of Voltage-Gated Ca2+-Channel Length 6e-39
1t0j_B224 Crystal Structure Of A Complex Between Voltage-Gate 3e-66
1t0j_B 224 Crystal Structure Of A Complex Between Voltage-Gate 1e-43
1t0h_B224 Crystal Structure Of The Rattus Norvegicus Voltage 1e-65
1t0h_B 224 Crystal Structure Of The Rattus Norvegicus Voltage 2e-41
1vyv_A359 Beta4 Subunit Of Ca2+ Channel Length = 359 2e-65
1vyv_A359 Beta4 Subunit Of Ca2+ Channel Length = 359 1e-40
1t0j_A132 Crystal Structure Of A Complex Between Voltage-Gate 1e-36
1t0h_A132 Crystal Structure Of The Rattus Norvegicus Voltage 7e-36
>pdb|4DEY|A Chain A, Crystal Structure Of The Voltage Dependent Calcium Channel Beta-2 Subunit In Complex With The Cav1.2 I-Ii Linker Length = 337 Back     alignment and structure

Iteration: 1

Score = 369 bits (946), Expect = e-102, Method: Compositional matrix adjust. Identities = 195/323 (60%), Positives = 233/323 (72%), Gaps = 39/323 (12%) Query: 11 SQPS-SDLSLDXXXXXXXXXXXXQALSQLEKARAKNVAFAVRTNVKYDGSIDDDSPVHGY 69 S+PS SD+SL+ QA +QLEKA+ K VAFAVRTNV Y + +DD PV G Sbjct: 1 SRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGM 60 Query: 70 AVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQTQ-ARNPKLYSS 128 A+SF+ +FLH+KEK++++WWIGRLVKEG E GFIPSPVKLEN+RLQ Q A+ KL+S Sbjct: 61 AISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLHSK 120 Query: 129 --------KTSSTSNLGALSSDAP----SP------------------------GMIIIT 152 KT T + S P P G I IT Sbjct: 121 EKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISIT 180 Query: 153 RVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQLVVLDCDTI 212 RVTADISLAKRS+++NPSK AI+ERSN+RSS L EVQ+EIER++ELA TLQLVVLD DTI Sbjct: 181 RVTADISLAKRSVLNNPSKHAIIERSNTRSS-LAEVQSEIERIFELARTLQLVVLDADTI 239 Query: 213 NHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQCPQEMFD 272 NHP+QL+KT+L+P +VY+KISSPKVLQRLIKSRGKSQ +HLNVQMVAA+KLAQCP E+FD Sbjct: 240 NHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFD 299 Query: 273 VILDENQLEDACEHIAEYLEAYW 295 VILDENQLEDACEH+A+YLEAYW Sbjct: 300 VILDENQLEDACEHLADYLEAYW 322
>pdb|4DEY|A Chain A, Crystal Structure Of The Voltage Dependent Calcium Channel Beta-2 Subunit In Complex With The Cav1.2 I-Ii Linker Length = 337 Back     alignment and structure
>pdb|4DEX|A Chain A, Crystal Structure Of The Voltage Dependent Calcium Channel Beta-2 Subunit In Complex With The Cav2.2 I-Ii Linker Length = 339 Back     alignment and structure
>pdb|4DEX|A Chain A, Crystal Structure Of The Voltage Dependent Calcium Channel Beta-2 Subunit In Complex With The Cav2.2 I-Ii Linker Length = 339 Back     alignment and structure
>pdb|1T3L|A Chain A, Structural Analysis Of The Voltage-Dependent Calcium Channel Beta Subunit Functional Core In Complex With Alpha1 Interaction Domain Length = 337 Back     alignment and structure
>pdb|1T3L|A Chain A, Structural Analysis Of The Voltage-Dependent Calcium Channel Beta Subunit Functional Core In Complex With Alpha1 Interaction Domain Length = 337 Back     alignment and structure
>pdb|1VYT|A Chain A, Beta3 Subunit Complexed With Aid Length = 351 Back     alignment and structure
>pdb|1VYT|A Chain A, Beta3 Subunit Complexed With Aid Length = 351 Back     alignment and structure
>pdb|1VYU|A Chain A, Beta3 Subunit Of Voltage-Gated Ca2+-Channel Length = 351 Back     alignment and structure
>pdb|1VYU|A Chain A, Beta3 Subunit Of Voltage-Gated Ca2+-Channel Length = 351 Back     alignment and structure
>pdb|1T0J|B Chain B, Crystal Structure Of A Complex Between Voltage-Gated Calcium Channel Beta2a Subunit And A Peptide Of The Alpha1c Subunit Length = 224 Back     alignment and structure
>pdb|1T0J|B Chain B, Crystal Structure Of A Complex Between Voltage-Gated Calcium Channel Beta2a Subunit And A Peptide Of The Alpha1c Subunit Length = 224 Back     alignment and structure
>pdb|1T0H|B Chain B, Crystal Structure Of The Rattus Norvegicus Voltage Gated Calcium Channel Beta Subunit Isoform 2a Length = 224 Back     alignment and structure
>pdb|1T0H|B Chain B, Crystal Structure Of The Rattus Norvegicus Voltage Gated Calcium Channel Beta Subunit Isoform 2a Length = 224 Back     alignment and structure
>pdb|1VYV|A Chain A, Beta4 Subunit Of Ca2+ Channel Length = 359 Back     alignment and structure
>pdb|1VYV|A Chain A, Beta4 Subunit Of Ca2+ Channel Length = 359 Back     alignment and structure
>pdb|1T0J|A Chain A, Crystal Structure Of A Complex Between Voltage-Gated Calcium Channel Beta2a Subunit And A Peptide Of The Alpha1c Subunit Length = 132 Back     alignment and structure
>pdb|1T0H|A Chain A, Crystal Structure Of The Rattus Norvegicus Voltage Gated Calcium Channel Beta Subunit Isoform 2a Length = 132 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query510
4dey_A337 Voltage-dependent L-type calcium channel subunit; 2e-92
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 2e-25
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 9e-04
3kfv_A308 Tight junction protein ZO-3; structural genomics c 3e-21
1kjw_A295 Postsynaptic density protein 95; protein-protein i 3e-12
2d46_A61 Calcium channel, voltage-dependent, beta 4 subunit 3e-11
2d46_A61 Calcium channel, voltage-dependent, beta 4 subunit 8e-11
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
2xkx_A721 Disks large homolog 4; structural protein, scaffol 1e-07
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 2e-04
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 2e-04
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 4e-04
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 5e-04
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 6e-04
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 6e-04
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 7e-04
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
 Score =  284 bits (727), Expect = 2e-92
 Identities = 202/337 (59%), Positives = 243/337 (72%), Gaps = 40/337 (11%)

Query: 11  SQPS-SDLSLDEEKETLRREKERQALSQLEKARAKNVAFAVRTNVKYDGSIDDDSPVHGY 69
           S+PS SD+SL+E++E +RRE ERQA +QLEKA+ K VAFAVRTNV Y  + +DD PV G 
Sbjct: 1   SRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGM 60

Query: 70  AVSFDIHEFLHIKEKYDSNWWIGRLVKEGSECGFIPSPVKLENLRLQQTQARNPKLYSSK 129
           A+SF+  +FLH+KEK++++WWIGRLVKEG E GFIPSPVKLEN+RLQ  Q        SK
Sbjct: 61  AISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLHSK 120

Query: 130 TSSTSNLGALSSDAPSPGM-------------------------------------IIIT 152
                         P   +                                     I IT
Sbjct: 121 EKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISIT 180

Query: 153 RVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQLVVLDCDTI 212
           RVTADISLAKRS+++NPSK AI+ERSN+RSS L EVQ+EIER++ELA TLQLVVLD DTI
Sbjct: 181 RVTADISLAKRSVLNNPSKHAIIERSNTRSS-LAEVQSEIERIFELARTLQLVVLDADTI 239

Query: 213 NHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQCPQEMFD 272
           NHP+QL+KT+L+P +VY+KISSPKVLQRLIKSRGKSQ +HLNVQMVAA+KLAQCP E+FD
Sbjct: 240 NHPAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFD 299

Query: 273 VILDENQLEDACEHIAEYLEAYWRATHPPA-APPQPL 308
           VILDENQLEDACEH+A+YLEAYW+ATHPP+   P PL
Sbjct: 300 VILDENQLEDACEHLADYLEAYWKATHPPSSNLPNPL 336


>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
>2d46_A Calcium channel, voltage-dependent, beta 4 subunit isoform A; Ca2+ channel, BETA4A subunit, nuclear magnetic resonance, alternative spliving; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>2d46_A Calcium channel, voltage-dependent, beta 4 subunit isoform A; Ca2+ channel, BETA4A subunit, nuclear magnetic resonance, alternative spliving; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
4dey_A337 Voltage-dependent L-type calcium channel subunit; 100.0
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 100.0
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 100.0
1kjw_A295 Postsynaptic density protein 95; protein-protein i 100.0
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 100.0
3kfv_A308 Tight junction protein ZO-3; structural genomics c 100.0
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 100.0
2xkx_A721 Disks large homolog 4; structural protein, scaffol 100.0
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 100.0
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 99.95
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 99.91
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 99.89
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 99.88
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.85
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.84
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.82
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.75
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 99.69
2d46_A61 Calcium channel, voltage-dependent, beta 4 subunit 99.67
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.61
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 99.51
2d46_A61 Calcium channel, voltage-dependent, beta 4 subunit 99.39
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.31
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.25
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.24
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.22
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.2
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.19
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 99.16
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.14
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.13
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.12
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.12
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.11
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.11
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.11
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.11
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.11
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.11
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.1
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.1
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.1
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.1
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.1
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.1
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.1
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.09
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.09
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.09
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.09
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.09
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.09
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.08
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.08
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.08
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.08
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.08
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.07
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.07
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.07
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.06
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.06
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.06
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.06
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.06
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.05
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.05
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.05
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.05
3u23_A65 CD2-associated protein; structural genomics, struc 99.05
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.05
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.04
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.04
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.04
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.04
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.04
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.04
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.04
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.04
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.04
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.04
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.04
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.04
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.04
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.04
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.04
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.03
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 99.03
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.03
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.03
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.03
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.03
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.03
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.03
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.03
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.02
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.02
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.02
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.02
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.02
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.01
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.01
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.01
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.01
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.01
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.01
1i07_A60 Epidermal growth factor receptor kinase substrate 99.01
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.01
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.01
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.0
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.0
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.0
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.0
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.0
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.0
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.0
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.0
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.0
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 98.99
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 98.99
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 98.99
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 98.99
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 98.99
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 98.99
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 98.99
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 98.99
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 98.98
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 98.98
2dil_A69 Proline-serine-threonine phosphatase-interacting p 98.98
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 98.98
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 98.98
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 98.98
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 98.98
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 98.98
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 98.97
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 98.97
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 98.97
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 98.97
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 98.97
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 98.97
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 98.97
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 98.97
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 98.97
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 98.96
2da9_A70 SH3-domain kinase binding protein 1; structural ge 98.96
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 98.96
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 98.96
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 98.96
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 98.96
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 98.96
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 98.95
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 98.95
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 98.95
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 98.95
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 98.95
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 98.94
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 98.94
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 98.94
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 98.94
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 98.94
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 98.94
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 98.93
2cuc_A70 SH3 domain containing ring finger 2; structural ge 98.93
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 98.93
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 98.93
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 98.93
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 98.93
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 98.93
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 98.93
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 98.92
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 98.92
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 98.92
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 98.91
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 98.91
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 98.91
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 98.9
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 98.9
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 98.9
1awj_A77 ITK; transferase, regulatory intramolecular comple 98.89
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 98.88
1wxb_A68 Epidermal growth factor receptor pathway substrate 98.88
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 98.88
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 98.86
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 98.86
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 98.85
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 98.82
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 98.81
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 98.79
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 98.79
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 98.79
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 98.78
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 98.77
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 98.74
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 98.71
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 98.68
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 98.67
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 98.67
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 98.67
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 98.65
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 98.63
1u3o_A82 Huntingtin-associated protein-interacting protein; 98.57
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.56
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.54
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.53
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 98.53
2pz1_A466 RHO guanine nucleotide exchange factor 4; helical 98.52
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.49
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.45
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 98.45
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.43
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.43
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 98.42
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 98.37
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 98.36
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.34
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.31
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 97.64
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.3
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 98.3
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 97.63
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 98.29
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 98.28
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 98.27
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 98.26
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 98.24
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 98.24
3tlx_A243 Adenylate kinase 2; structural genomics, structura 98.23
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 98.22
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.17
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 98.11
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 98.09
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 98.09
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 98.08
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 98.07
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 98.07
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 98.02
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 97.95
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 97.92
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 97.91
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 97.9
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 97.9
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 97.89
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 97.88
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 97.87
3vaa_A199 Shikimate kinase, SK; structural genomics, center 97.86
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 97.85
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 97.83
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 97.82
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 97.76
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 97.75
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 97.74
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 97.73
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 97.71
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 97.71
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 97.7
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 97.69
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 97.68
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 97.64
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 97.63
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 97.53
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 97.53
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 97.51
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 97.5
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 97.38
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 97.36
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 97.36
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 97.35
2vli_A183 Antibiotic resistance protein; transferase, tunica 97.34
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 97.34
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 97.32
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 97.31
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 97.25
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 97.23
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 97.17
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 97.14
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 97.11
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 96.99
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 96.86
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 96.81
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 96.8
4hlc_A205 DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri 96.78
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 96.73
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 96.71
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 96.71
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 96.7
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 96.69
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 96.58
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 96.56
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 96.54
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 96.54
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 96.54
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 96.52
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 96.45
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 96.45
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 96.4
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 96.39
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 96.39
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 96.36
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 96.33
3fdi_A201 Uncharacterized protein; cytidylate kinase like pr 96.33
4i1u_A210 Dephospho-COA kinase; structural genomics, niaid, 96.32
3eph_A409 TRNA isopentenyltransferase; transferase, alternat 96.29
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 96.28
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 96.27
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 96.24
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 96.24
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 96.18
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 96.13
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 96.09
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 95.94
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 95.88
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 95.88
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 95.73
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 95.63
1via_A175 Shikimate kinase; structural genomics, transferase 95.52
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 95.36
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 95.29
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.29
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfuryl 95.24
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 95.16
3hdt_A223 Putative kinase; structura genomics, PSI-2, protei 95.12
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 95.11
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 94.82
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 94.8
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 94.53
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 94.29
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.28
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 94.26
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.23
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 93.71
3gmt_A230 Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle 93.35
2axn_A520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 93.32
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 93.01
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 92.81
3r20_A233 Cytidylate kinase; structural genomics, seattle st 92.56
3pvs_A447 Replication-associated recombination protein A; ma 91.02
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 90.74
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 89.92
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 89.85
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 89.7
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 89.41
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 89.0
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 87.69
1kag_A173 SKI, shikimate kinase I; transferase, structural g 87.56
1mky_A439 Probable GTP-binding protein ENGA; GTPase, DER, KH 87.43
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 87.43
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 87.34
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 87.2
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 86.69
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 86.29
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 86.22
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 86.22
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 86.1
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 85.86
1bif_A469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 85.71
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 85.7
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 85.69
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 85.6
3lxx_A239 GTPase IMAP family member 4; structural genomics c 85.57
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 85.53
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 85.47
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 85.46
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 85.39
2ged_A193 SR-beta, signal recognition particle receptor beta 85.26
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 85.24
4a74_A231 DNA repair and recombination protein RADA; hydrola 85.11
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 84.98
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosph 84.97
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 84.91
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 84.76
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 84.74
2wji_A165 Ferrous iron transport protein B homolog; membrane 84.64
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 84.6
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 84.6
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 84.57
1b0u_A262 Histidine permease; ABC transporter, transport pro 84.52
1wf3_A301 GTP-binding protein; GTPase, riken structural geno 84.33
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 84.14
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 84.02
1g6h_A257 High-affinity branched-chain amino acid transport 83.98
4dzz_A206 Plasmid partitioning protein PARF; deviant walker 83.96
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 83.87
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 83.83
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 83.8
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 83.75
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 83.74
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 83.66
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 83.59
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 83.55
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 83.51
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 83.48
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 83.41
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 83.34
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 83.3
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 83.27
1ji0_A240 ABC transporter; ATP binding protein, structural g 83.22
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 83.22
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 83.09
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 83.0
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 82.96
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 82.93
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 82.85
3lxw_A247 GTPase IMAP family member 1; immunity, structural 82.79
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 82.76
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 82.54
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 82.51
3cnl_A262 YLQF, putative uncharacterized protein; circular p 82.51
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 82.46
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 82.44
3llu_A196 RAS-related GTP-binding protein C; structural geno 82.4
1sgw_A214 Putative ABC transporter; structural genomics, P p 82.39
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 82.36
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 82.3
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 82.29
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 82.25
1ega_A301 Protein (GTP-binding protein ERA); GTPase, RNA-bin 82.21
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 82.19
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 82.15
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 82.14
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 82.0
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 81.91
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 81.87
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 81.86
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 81.85
2ghi_A260 Transport protein; multidrug resistance protein, M 81.79
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 81.76
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 81.73
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 81.7
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 81.67
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 81.65
1puj_A282 YLQF, conserved hypothetical protein YLQF; structu 81.64
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 81.62
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 81.59
3iev_A308 GTP-binding protein ERA; ERA, GTPase, KH domain, a 81.57
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 81.57
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 81.46
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 81.45
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 81.44
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 81.38
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 81.35
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 81.34
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 81.29
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 81.29
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 81.27
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 81.25
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 81.23
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 80.98
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 80.92
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 80.88
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 80.88
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 80.84
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 80.81
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 80.79
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 80.46
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 80.42
2eyu_A261 Twitching motility protein PILT; pilus retraction 80.39
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 80.37
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 80.35
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 80.34
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 80.32
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 80.29
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 80.29
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 80.28
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 80.23
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
Probab=100.00  E-value=4.2e-60  Score=484.93  Aligned_cols=293  Identities=56%  Similarity=0.867  Sum_probs=223.4

Q ss_pred             CcCC-CCccchhhhHHHhHHHHHHHHHHHhhhccCCCeeEEEEeeccCCCCCCCCCCCCccccccCCceEEEEeecCCCc
Q psy6613          11 SQPS-SDLSLDEEKETLRREKERQALSQLEKARAKNVAFAVRTNVKYDGSIDDDSPVHGYAVSFDIHEFLHIKEKYDSNW   89 (510)
Q Consensus        11 ~~~~-~d~~~~~~~~~~~~~~~~~a~~~L~~a~~k~~~~~VRAlfdY~~~~D~~iPc~e~~LsF~~GDiL~V~~~~d~~W   89 (510)
                      |||| ||+|+|+|.|++|+|+|++|+.||++|+.|++.+||||+|||+|..|+++||++++|+|++||||+|+++.|++|
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~k~~~~~vrAlfdY~~~~d~d~P~~e~~LsF~~GDiL~V~~~~d~~W   80 (337)
T 4dey_A            1 SRPSDSDVSLEEDREAVRREAERQAQAQLEKAKTKPVAFAVRTNVSYSAAHEDDVPVPGMAISFEAKDFLHVKEKFNNDW   80 (337)
T ss_dssp             ----------CTTGGGHHHHHHHHHHHHHHHTSSSCCCEEEEESSCBCCCGGGCCSSTTCBCCBCTTCEEEEEEECSSSE
T ss_pred             CCCCccccchhhHHHHHHHHHHHHHHHhhhhccCCCccEEEEEccccCCCCCCCCCcccccccccCCCEEEEEecCCCCe
Confidence            6899 999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEEccCCCceeeecChhHHHHHHHHhhhcc-CCCcccccC--C-CCCCCC-CCCCCCCCCCCeE-EecCcCChHH---
Q psy6613          90 WIGRLVKEGSECGFIPSPVKLENLRLQQTQAR-NPKLYSSKT--S-STSNLG-ALSSDAPSPGMII-ITRVTADISL---  160 (510)
Q Consensus        90 Wqar~v~~~~~~GlIPS~~~~Errr~~~~~kk-~~~l~~sk~--~-s~~~~~-~~~~d~Ps~~RpI-~GPsGvGKsT---  160 (510)
                      |+||+++++|..|||||+.++|+++..+.++. +..+..++.  . ...+.. .-+..+|+.+-+| +||++.|-.+   
T Consensus        81 Wqar~~~~~g~~GlIPS~~~~E~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~Ye~vp~~RPvvlvGP~~~g~~~td~  160 (337)
T 4dey_A           81 WIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAKEFKLHSKEKRMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDM  160 (337)
T ss_dssp             EEEEESSTTCCCEEEECHHHHHHHHHHHHHHCC-------------------CCSEEEECSSCCEEEECSSCTTSHHHHH
T ss_pred             EEEEECCCCCCccEecCHHHHHHHHHhhhhccccCCCCcccccccccccCCCCCCccccCCCCceEEECCccccchhHHH
Confidence            99999987788999999999999988765421 111100000  0 001100 0112236554444 9999999874   


Q ss_pred             HHHHHhc-CCCCceeeecCCCchh-------------------hhhhh--------cccHHHHHHHHHcCCeEEEEeccC
Q psy6613         161 AKRSLMS-NPSKRAIMERSNSRSS-------------------VLTEV--------QTEIERVYELASTLQLVVLDCDTI  212 (510)
Q Consensus       161 L~~rLL~-~P~~F~~sVshTTR~p-------------------Fe~~I--------~TslesI~~vi~sGKi~ILDID~q  212 (510)
                      +.+.|+. .+.+|...|++| |.+                   |+..+        ++.+++|.++.++|++||||||+|
T Consensus       161 m~~~l~d~l~~~F~~~i~~t-R~~~d~~~~~r~~~~~~~~~~~~e~~~~~~~~~ev~seVe~i~~v~~~Gk~vILDIDvQ  239 (337)
T 4dey_A          161 MQKALFDFLKHRFEGRISIT-RVTADISLAKRSVLNNPSKHAIIERSNTRSSLAEVQSEIERIFELARTLQLVVLDADTI  239 (337)
T ss_dssp             HHHHHHHHHHHHTTTSEEEE-EECSCGGGC-------------------CCCHHHHHHHHHHHHHHTTTCCEEEEEETTC
T ss_pred             HHHHHHHhhHHhcCCccceE-eecchhhhcchhhhhcccchhhhcccccccchHHHHhHHHHHHHHHhCCCEEEEEeCcH
Confidence            4556766 667777777665 333                   33222        268888999999999999999999


Q ss_pred             -CchhHhhhc-CCCceEEEEeCCCHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHhcCCCCccEEEeCCCHHHHHHHHHHH
Q psy6613         213 -NHPSQLAKT-NLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQCPQEMFDVILDENQLEDACEHIAEY  290 (510)
Q Consensus       213 -g~~lq~lks-~l~PivIFIkPPS~e~L~~rLr~Rgt~~~e~i~kRL~aa~eLEq~~~~~FD~VIvNDdLd~A~~eL~~i  290 (510)
                       |  ++.++. .++|++|||+|||+++|++||++||++..+.+.++|+.++++.+++.+.|||||+||||+.||++|.+|
T Consensus       240 nG--a~qlk~~~~~~i~IFI~PPS~eeLe~RL~~RGt~~~~rl~~al~~ae~E~~~~~~~FDyvIVNDdLe~A~~~L~~i  317 (337)
T 4dey_A          240 NH--PAQLSKTSLAPIVVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQCPPELFDVILDENQLEDACEHLADY  317 (337)
T ss_dssp             CS--GGGTTTSSCCCEEEEECCSCHHHHHHHHHTTCHHHHTTHHHHHHHHHHHHHSCGGGCSEEECCSSHHHHHHHHHHH
T ss_pred             HH--HHHHHhcCCCCEEEEEECcCHHHHHHHHHhCCchHHHHHHHHHHHHHHHHhhCcccCCEEEECCCHHHHHHHHHHH
Confidence             9  666666 789999999999999999999999986666666666555555566789999999999999999999999


Q ss_pred             HHHHHHhcCCCCCCCC
Q psy6613         291 LEAYWRATHPPAAPPQ  306 (510)
Q Consensus       291 leai~~a~h~p~~~p~  306 (510)
                      |++||++.|+|...|+
T Consensus       318 I~~~~~~~h~~~~~~~  333 (337)
T 4dey_A          318 LEAYWKATHPPSSNLP  333 (337)
T ss_dssp             HHHHHHHHSCCC----
T ss_pred             HHHHHhccCCCCCCCC
Confidence            9999999999988876



>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>2d46_A Calcium channel, voltage-dependent, beta 4 subunit isoform A; Ca2+ channel, BETA4A subunit, nuclear magnetic resonance, alternative spliving; NMR {Homo sapiens} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>2d46_A Calcium channel, voltage-dependent, beta 4 subunit isoform A; Ca2+ channel, BETA4A subunit, nuclear magnetic resonance, alternative spliving; NMR {Homo sapiens} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} Back     alignment and structure
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1wf3_A GTP-binding protein; GTPase, riken structural genomics/prote initiative, RSGI, structural genomics, hydrolase; HET: GNP; 1.88A {Thermus thermophilus} SCOP: c.37.1.8 d.52.3.1 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 510
d1t0hb_219 c.37.1.1 (B:) Guanylate kinase-like domain of the 4e-91
d1t0hb_ 219 c.37.1.1 (B:) Guanylate kinase-like domain of the 2e-60
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 6e-34
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 0.001
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 1e-33
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 4e-33
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 1e-10
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 3e-04
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 8e-04
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 8e-04
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 8e-04
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 8e-04
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 0.001
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 0.001
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 0.001
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 0.001
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 0.002
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 0.002
>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 219 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of the L-type calcium channel
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
 Score =  275 bits (704), Expect = 4e-91
 Identities = 130/165 (78%), Positives = 149/165 (90%), Gaps = 3/165 (1%)

Query: 146 PGMIIITRVTADISLAKRSLMSNPSKRAIMERSNSRSSVLTEVQTEIERVYELASTLQLV 205
            G I ITRVTADISLAKRS+++NPSK AI+ERSN+RSS L EVQ+EIER++ELA TLQLV
Sbjct: 52  EGRISITRVTADISLAKRSVLNNPSKHAIIERSNTRSS-LAEVQSEIERIFELARTLQLV 110

Query: 206 VLDCDTINHPSQLAKTNLSPCIVYLKISSPKVLQRLIKSRGKSQTRHLNVQMVAAEKLAQ 265
           VLD DTINHP+QL+KT+L+P IVY+KISSPKVLQRLIKSRGKSQ +HLNVQMVAA+KLAQ
Sbjct: 111 VLDADTINHPAQLSKTSLAPIIVYVKISSPKVLQRLIKSRGKSQAKHLNVQMVAADKLAQ 170

Query: 266 C-PQEMFDVILDENQLEDACEHIAEYLEAYWRATHPPA-APPQPL 308
           C PQE FDVILDENQLEDACEH+A+YLEAYW+ATHPP+   P PL
Sbjct: 171 CPPQESFDVILDENQLEDACEHLADYLEAYWKATHPPSSNLPNPL 215


>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 219 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query510
d1t0hb_ 219 Guanylate kinase-like domain of the L-type calcium 100.0
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 99.96
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 99.95
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 99.95
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 99.95
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 99.94
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 99.94
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 99.93
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.93
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.92
d1t0hb_219 Guanylate kinase-like domain of the L-type calcium 99.9
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.66
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.29
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.28
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.22
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.21
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.2
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.19
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.18
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.16
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.1
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.1
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.07
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.06
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.06
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.05
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.04
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.04
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.03
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.03
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.02
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.02
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.99
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 98.99
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.98
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 98.97
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 98.96
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 98.95
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 98.95
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.94
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 98.93
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.93
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.91
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 98.9
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 98.89
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 98.88
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 98.88
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.87
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 98.87
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 98.85
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 98.8
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 98.78
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 98.77
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 98.71
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 98.52
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.5
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 98.33
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 98.23
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 98.22
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 98.18
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 98.15
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 98.11
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.92
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 97.88
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 97.8
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 97.78
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 97.72
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.68
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 97.66
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 97.58
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 97.56
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.54
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.5
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 97.47
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 97.4
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 97.39
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 97.34
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.34
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 97.22
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.16
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 97.13
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 97.09
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.04
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.9
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.89
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 96.84
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 96.72
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.7
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.66
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 96.43
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.2
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.12
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 95.98
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 95.79
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.49
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 95.28
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 94.54
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 94.38
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 94.04
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 93.6
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 92.9
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 92.89
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 92.7
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 92.02
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 91.79
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 91.58
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 91.31
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 90.94
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 90.8
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 90.49
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 89.99
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 89.96
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 89.8
d1nrjb_209 Signal recognition particle receptor beta-subunit 89.59
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 89.53
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 88.46
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 88.42
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 88.01
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 87.38
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 87.33
d2awna2232 Maltose transport protein MalK, N-terminal domain 87.28
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 87.24
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 87.13
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 87.1
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 87.09
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 87.02
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 86.85
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 86.82
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 86.68
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 86.54
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 86.48
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 86.47
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 86.4
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 86.34
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 86.31
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 86.23
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 86.16
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 86.01
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 85.94
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 85.89
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 85.81
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 85.65
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 85.62
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 85.6
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 85.57
d1g2912240 Maltose transport protein MalK, N-terminal domain 85.53
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 85.51
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 85.48
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 85.39
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 85.31
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 85.21
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 85.21
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 85.19
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 85.02
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 84.94
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 84.9
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 84.85
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 84.57
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 84.45
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 84.38
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 84.36
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 84.34
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 84.33
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 84.32
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 84.29
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 84.28
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 84.24
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 84.19
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 84.13
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 84.06
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 83.97
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 83.95
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 83.88
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 83.74
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 83.74
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 83.74
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 83.7
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 83.67
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 83.63
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 83.49
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 83.39
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 83.23
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 83.15
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 83.13
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 83.05
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 82.89
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 82.82
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 82.81
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 82.51
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 82.39
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 82.36
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 82.36
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 82.14
d1um8a_364 ClpX {Helicobacter pylori [TaxId: 210]} 82.07
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 81.99
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 81.78
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 81.77
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 81.76
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 81.75
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 81.24
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 80.74
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 80.73
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 80.7
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 80.66
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 80.62
d2fh5b1207 Signal recognition particle receptor beta-subunit 80.42
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 80.38
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 80.37
>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of the L-type calcium channel
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Probab=100.00  E-value=2.8e-57  Score=424.82  Aligned_cols=111  Identities=81%  Similarity=1.165  Sum_probs=93.1

Q ss_pred             hhhcccccCCCCCccccCCCcceEEeCCCCCCchhHHHHHHHHHHHHhhhcCCcEEEEEEecchhhHHhhccCCcccccc
Q psy6613         396 KKIFFKKQETTTPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRIIITRVTADISLAKRSLMSNPSKRAI  475 (510)
Q Consensus       396 ~~~~~~~~~~~~~y~~~p~~rp~~~~gp~~~~~~~~~~m~~al~~~l~~~f~~~i~~~~~~~d~~~~~~~~~~~~~~~~~  475 (510)
                      |||||||+|++||||||||||||||||||||||||||||||||||||||||+|||+|||||||||+||||++|||+|+++
T Consensus         1 r~pffkk~~~~~PYdVVPsmRPvvlvGPsLkGyevTDMMqkALfD~Lk~rF~grI~itrv~aDIslakrs~~~n~~k~~~   80 (219)
T d1t0hb_           1 RMPFFKKTEHTPPYDVVPSMRPVVLVGPSLKGYEVTDMMQKALFDFLKHRFEGRISITRVTADISLAKRSVLNNPSKHAI   80 (219)
T ss_dssp             CCCC------CCSEEEECSSCCEEEECSSCTTSHHHHHHHHHHHHHHHHHTTTSEEEEEECSCGGGCC----------CC
T ss_pred             CCccccccCCCCCcccccCCCceEEECCCcccccHHHHHHHHHHHHHHHhcCCceEEEEEecchhHhhhccccCchhhhh
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCCCcchhHHHHHHHHHHHHHhhcccccc
Q psy6613         476 MERSNSRSSVLTEVQTEIERVYELASTLQVYY  507 (510)
Q Consensus       476 ~~~~~~~~~~~~~~~~e~~~i~~~~~~~~l~~  507 (510)
                      ++|+++|++ ++|||+||||||||||+||||+
T Consensus        81 ~~rs~~r~~-~~eVq~eIErIfelar~lqLvv  111 (219)
T d1t0hb_          81 IERSNTRSS-LAEVQSEIERIFELARTLQLVV  111 (219)
T ss_dssp             CCCCSSSSC-HHHHHHHHHHHHHHHTTCCEEE
T ss_pred             hhcccccch-HHHHHHHHHHHHHHhhcccEEE
Confidence            999999987 9999999999999999999985



>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0hb_ c.37.1.1 (B:) Guanylate kinase-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure