Diaphorina citri psyllid: psy6637

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MSPEDQKKWEEEEMGQKVSFEQCHIDPAPFQLVERTSLLKVHSIFSLVGVNHAYVTAIGRLVGVVGLKEVRNDSHLSSVVIRSITMADGLGEGQWNAQEKINKPC
ccHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHccccEEEEEEccEEEEEEEHHHHHHHccccccEEEccccccccccccccccccccccc
**PEDQKKWEEEEMGQKVSFEQCHIDPAPFQLVERTSLLKVHSIFSLVGVNHAYVTAIGRLVGVVGLKEVRNDSHLSSVVIRSITMADGLG************P*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPEDQKKWEEEEMGQKVSFEQCHIDPAPFQLVERTSLLKVHSIFSLVGVNHAYVTAIGRLVGVVGLKEVRNDSHLSSVVIRSITMADGLGEGQWNAQEKINKPC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Chloride channel protein 2 Voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport.confidentQ9VGH7
Chloride channel protein 2 Voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport.confidentP35525
Chloride channel protein 2 Voltage-gated chloride channel. Chloride channels have several functions including the regulation of cell volume; membrane potential stabilization, signal transduction and transepithelial transport.confidentQ9R0A1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0043204 [CC]perikaryonprobableGO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0005247 [MF]voltage-gated chloride channel activityprobableGO:0022891, GO:0005253, GO:0022892, GO:0005215, GO:0005216, GO:0015108, GO:0015075, GO:0022832, GO:0022857, GO:0008509, GO:0003674, GO:0022838, GO:0015103, GO:0015267, GO:0022803, GO:0022839, GO:0005244, GO:0005254, GO:0008308, GO:0022836
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D4Z, chain A
Confidence level:very confident
Coverage over the Query: 1-76
View the alignment between query and template
View the model in PyMOL
Template: 3KXR, chain A
Confidence level:probable
Coverage over the Query: 20-77
View the alignment between query and template
View the model in PyMOL