Psyllid ID: psy6637
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 105 | ||||||
| 242009651 | 919 | Chloride channel protein ClC-Ka, putativ | 0.676 | 0.077 | 0.845 | 1e-28 | |
| 307170777 | 1008 | Chloride channel protein 2 [Camponotus f | 0.676 | 0.070 | 0.816 | 1e-28 | |
| 383854577 | 1004 | PREDICTED: chloride channel protein 2-li | 0.676 | 0.070 | 0.830 | 2e-28 | |
| 380022339 | 998 | PREDICTED: chloride channel protein 2-li | 0.676 | 0.071 | 0.830 | 3e-28 | |
| 345495188 | 1037 | PREDICTED: chloride channel protein 2-li | 0.676 | 0.068 | 0.830 | 3e-28 | |
| 328785091 | 998 | PREDICTED: chloride channel protein 2-li | 0.676 | 0.071 | 0.830 | 3e-28 | |
| 307195651 | 216 | Chloride channel protein 2 [Harpegnathos | 0.676 | 0.328 | 0.816 | 3e-28 | |
| 350397649 | 1004 | PREDICTED: chloride channel protein 2-li | 0.676 | 0.070 | 0.830 | 5e-28 | |
| 340724384 | 1004 | PREDICTED: chloride channel protein 2-li | 0.676 | 0.070 | 0.830 | 5e-28 | |
| 322800715 | 929 | hypothetical protein SINV_00748 [Solenop | 0.676 | 0.076 | 0.816 | 6e-28 |
| >gi|242009651|ref|XP_002425596.1| Chloride channel protein ClC-Ka, putative [Pediculus humanus corporis] gi|212509489|gb|EEB12858.1| Chloride channel protein ClC-Ka, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 130 bits (327), Expect = 1e-28, Method: Compositional matrix adjust.
Identities = 60/71 (84%), Positives = 66/71 (92%)
Query: 1 MSPEDQKKWEEEEMGQKVSFEQCHIDPAPFQLVERTSLLKVHSIFSLVGVNHAYVTAIGR 60
MSPEDQK+WEEEEM V+FE HIDPAPFQLVERTSLLKVHS+FS+VGVNHAYVTAIGR
Sbjct: 798 MSPEDQKQWEEEEMSVPVNFESSHIDPAPFQLVERTSLLKVHSLFSMVGVNHAYVTAIGR 857
Query: 61 LVGVVGLKEVR 71
L+GVVGLKE+R
Sbjct: 858 LIGVVGLKELR 868
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307170777|gb|EFN62902.1| Chloride channel protein 2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383854577|ref|XP_003702797.1| PREDICTED: chloride channel protein 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380022339|ref|XP_003695007.1| PREDICTED: chloride channel protein 2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|345495188|ref|XP_001604692.2| PREDICTED: chloride channel protein 2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328785091|ref|XP_392015.3| PREDICTED: chloride channel protein 2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307195651|gb|EFN77493.1| Chloride channel protein 2 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|350397649|ref|XP_003484942.1| PREDICTED: chloride channel protein 2-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340724384|ref|XP_003400562.1| PREDICTED: chloride channel protein 2-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|322800715|gb|EFZ21619.1| hypothetical protein SINV_00748 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 105 | ||||||
| FB|FBgn0051116 | 1193 | ClC-a "Chloride channel-a" [Dr | 0.676 | 0.059 | 0.726 | 6.3e-23 | |
| UNIPROTKB|P51788 | 898 | CLCN2 "Chloride channel protei | 0.676 | 0.079 | 0.661 | 5.5e-21 | |
| RGD|2361 | 907 | Clcn2 "chloride channel, volta | 0.676 | 0.078 | 0.661 | 5.6e-21 | |
| MGI|MGI:105061 | 908 | Clcn2 "chloride channel 2" [Mu | 0.676 | 0.078 | 0.661 | 5.6e-21 | |
| UNIPROTKB|F1N0K8 | 903 | CLCN2 "Uncharacterized protein | 0.676 | 0.078 | 0.647 | 1.2e-20 | |
| UNIPROTKB|I3LMX7 | 910 | CLCN2 "Uncharacterized protein | 0.676 | 0.078 | 0.647 | 1.2e-20 | |
| UNIPROTKB|F1PJ67 | 904 | CLCN2 "Uncharacterized protein | 0.676 | 0.078 | 0.633 | 4e-20 | |
| ZFIN|ZDB-GENE-070705-19 | 940 | clcn2 "chloride channel 2" [Da | 0.676 | 0.075 | 0.633 | 3.9e-19 | |
| ZFIN|ZDB-GENE-100921-11 | 817 | clcn1b "chloride channel 1b" [ | 0.676 | 0.086 | 0.591 | 5.1e-19 | |
| UNIPROTKB|F1NAL0 | 847 | F1NAL0 "Uncharacterized protei | 0.676 | 0.083 | 0.577 | 6.4e-18 |
| FB|FBgn0051116 ClC-a "Chloride channel-a" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 278 (102.9 bits), Expect = 6.3e-23, P = 6.3e-23
Identities = 53/73 (72%), Positives = 64/73 (87%)
Query: 1 MSPEDQKKWEEEEMGQKVSFEQC--HIDPAPFQLVERTSLLKVHSIFSLVGVNHAYVTAI 58
MSPEDQK+WE EEM + + ++ HIDP+PFQLVERTS+LKVHS+FS+VG+NHAYVT I
Sbjct: 1022 MSPEDQKQWELEEMLKPIDLQKANVHIDPSPFQLVERTSILKVHSLFSMVGINHAYVTKI 1081
Query: 59 GRLVGVVGLKEVR 71
GRLVGVVGLKE+R
Sbjct: 1082 GRLVGVVGLKELR 1094
|
|
| UNIPROTKB|P51788 CLCN2 "Chloride channel protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|2361 Clcn2 "chloride channel, voltage-sensitive 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:105061 Clcn2 "chloride channel 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N0K8 CLCN2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LMX7 CLCN2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PJ67 CLCN2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070705-19 clcn2 "chloride channel 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-100921-11 clcn1b "chloride channel 1b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NAL0 F1NAL0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 105 | |||
| cd04591 | 105 | cd04591, CBS_pair_EriC_assoc_euk_bac, This cd cont | 1e-20 |
| >gnl|CDD|239964 cd04591, CBS_pair_EriC_assoc_euk_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
Score = 78.8 bits (195), Expect = 1e-20
Identities = 22/50 (44%), Positives = 32/50 (64%)
Query: 24 HIDPAPFQLVERTSLLKVHSIFSLVGVNHAYVTAIGRLVGVVGLKEVRND 73
+IDP+PF + RTSL KVH +F +G+ H V GRLVG++ K++
Sbjct: 56 YIDPSPFTVSPRTSLEKVHQLFRKLGLRHLLVVDEGRLVGIITRKDLLKA 105
|
These ion channels are proteins with a seemingly simple task of allowing the passive flow of chloride ions across biological membranes. CIC-type chloride channels come from all kingdoms of life, have several gene families, and can be gated by voltage. The members of the CIC-type chloride channel are double-barreled: two proteins forming homodimers at a broad interface formed by four helices from each protein. The two pores are not found at this interface, but are completely contained within each subunit, as deduced from the mutational analyses, unlike many other channels, in which four or five identical or structurally related subunits jointly form one pore. CBS is a small domain originally identified in cystathionine beta-synthase and subsequently found in a wide range of different proteins. CBS domains usually come in tandem repeats, which associate to form a so-called Bateman domain or a CBS pair which is reflected in this model. The interface between the two CBS domains forms a cleft that is a potential ligand binding site. The CBS pair coexists with a variety of other functional domains. It has been proposed that the CBS domain may play a regulatory role, although its exact function is unknown. Mutations of conserved residues within this domain in CLC chloride channel family members have been associated with classic Bartter syndrome, Osteopetrosis, Dent's disease, idiopathic generalized epilepsy, and myotonia. Length = 105 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| KOG0476|consensus | 931 | 99.91 | ||
| KOG0474|consensus | 762 | 99.22 | ||
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 99.08 | |
| KOG0475|consensus | 696 | 98.91 | ||
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 98.66 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 98.56 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 98.56 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 98.53 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 98.52 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 98.5 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 98.49 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 98.49 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 98.49 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 98.44 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 98.43 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 98.42 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 98.41 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 98.38 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 98.38 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 98.37 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 98.37 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 98.37 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 98.34 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 98.33 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 98.33 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 98.33 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 98.32 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 98.31 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 98.31 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 98.3 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 98.3 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 98.3 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 98.29 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 98.29 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 98.29 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 98.28 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 98.28 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 98.28 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 98.28 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 98.27 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 98.27 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 98.26 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 98.25 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 98.25 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 98.25 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 98.23 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 98.23 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 98.23 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 98.21 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 98.21 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 98.2 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 98.19 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 98.19 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 98.19 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 98.18 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 98.18 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 98.18 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 98.17 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 98.17 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 98.16 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 98.16 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 98.16 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 98.16 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 98.16 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 98.15 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 98.15 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 98.14 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 98.13 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 98.13 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 98.13 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 98.13 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 98.12 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 98.12 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 98.12 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 98.11 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 98.11 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 98.1 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 98.09 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 98.09 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 98.06 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 98.06 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 98.05 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 98.05 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 98.03 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 98.03 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 98.03 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 98.02 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 98.02 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 98.02 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 98.01 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 98.01 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 98.01 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 98.01 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 98.0 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 98.0 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.98 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.98 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 97.97 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 97.97 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 97.97 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 97.97 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 97.97 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.96 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 97.96 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 97.96 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 97.95 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 97.94 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 97.94 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 97.93 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 97.93 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 97.93 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 97.93 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 97.92 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 97.92 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 97.9 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 97.9 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 97.9 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 97.89 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 97.89 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 97.89 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 97.89 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 97.89 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 97.89 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 97.87 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 97.87 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 97.86 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 97.86 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 97.85 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 97.85 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 97.84 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 97.84 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 97.83 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 97.83 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 97.82 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 97.8 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 97.8 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.79 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 97.79 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 97.78 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 97.75 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 97.75 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 97.75 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.74 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 97.73 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 97.71 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 97.7 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 97.7 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 97.68 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 97.64 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 97.6 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 97.6 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 97.59 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 97.56 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 97.54 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 97.53 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 97.5 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 97.49 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 97.48 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 97.46 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 97.46 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 97.43 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 97.39 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 97.36 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 97.35 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 97.35 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 97.33 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 97.32 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 97.28 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 97.22 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 97.22 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 97.19 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 97.16 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 97.11 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 97.1 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 96.99 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 96.96 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 96.94 | |
| KOG1764|consensus | 381 | 96.91 | ||
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 96.89 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 96.69 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 96.45 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 96.27 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 95.99 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 95.81 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 95.72 | |
| KOG2550|consensus | 503 | 94.87 | ||
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 93.39 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 91.78 | |
| KOG1764|consensus | 381 | 91.56 | ||
| PRK11573 | 413 | hypothetical protein; Provisional | 90.33 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 88.18 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 86.84 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 86.68 | |
| KOG2550|consensus | 503 | 86.66 | ||
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 85.67 |
| >KOG0476|consensus | Back alignment and domain information |
|---|
Probab=99.91 E-value=2.6e-25 Score=195.22 Aligned_cols=77 Identities=61% Similarity=1.014 Sum_probs=75.4
Q ss_pred CChHHHHhHHHHHhcCcccCCccccCCCceEEeccCCHHHHHHHHHHhCCcEEEEeeCCeEEEEEehHHHHHhhccC
Q psy6637 1 MSPEDQKKWEEEEMGQKVSFEQCHIDPAPFQLVERTSLLKVHSIFSLVGVNHAYVTAIGRLVGVVGLKEVRNDSHLS 77 (105)
Q Consensus 1 ~~~~e~~~we~~~l~~~idl~~~~id~sP~qv~~~tsL~kv~~LF~~Lglr~l~Vt~~GrLVGvVT~kDL~kaI~~~ 77 (105)
|++|||++||+++|.+++|++.|.|||+||||++.|||+|||+||++||++|+|||+.|||||||++|||+|||++-
T Consensus 784 ~~~eei~~we~~~l~~~ld~~~~~IDpaPfQLve~TSL~K~HtLFSLLgL~~AYVT~~GrLvGVValkELRkAie~I 860 (931)
T KOG0476|consen 784 LSAEEIKEWEEEQLSQKLDLDECAIDPAPFQLVEGTSLYKVHTLFSLLGLNHAYVTSCGRLVGVVALKELRKAIENI 860 (931)
T ss_pred cChhhhhHHHHHHhccccchhhCCCCCCceeeeccchHHHHHHHHHHhccchhhhcccCcEEEEEEHHHHHHHHHhc
Confidence 68999999999999999999999999999999999999999999999999999999999999999999999999983
|
|
| >KOG0474|consensus | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >KOG0475|consensus | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1764|consensus | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >KOG2550|consensus | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >KOG1764|consensus | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG2550|consensus | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 105 | ||||
| 2d4z_A | 250 | Crystal Structure Of The Cytoplasmic Domain Of The | 4e-17 |
| >pdb|2D4Z|A Chain A, Crystal Structure Of The Cytoplasmic Domain Of The Chloride Channel Clc-0 Length = 250 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 105 | |||
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 1e-26 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 9e-16 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 1e-12 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 1e-05 |
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 Length = 250 | Back alignment and structure |
|---|
Score = 97.9 bits (242), Expect = 1e-26
Identities = 37/71 (52%), Positives = 54/71 (76%)
Query: 1 MSPEDQKKWEEEEMGQKVSFEQCHIDPAPFQLVERTSLLKVHSIFSLVGVNHAYVTAIGR 60
++ E+ +WE+ E V+FE C ID +PFQLVE TSL K H++FSL+G++ AYVT++G+
Sbjct: 171 LTLEEIYRWEQREKNVVVNFETCRIDQSPFQLVEGTSLQKTHTLFSLLGLDRAYVTSMGK 230
Query: 61 LVGVVGLKEVR 71
LVGVV L E++
Sbjct: 231 LVGVVALAEIQ 241
|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} Length = 632 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} Length = 164 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* Length = 185 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.91 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.1 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 99.09 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 99.01 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 98.92 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.91 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 98.91 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.88 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 98.87 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 98.87 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 98.85 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 98.85 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.84 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 98.84 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 98.84 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 98.83 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 98.82 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 98.81 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 98.81 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 98.81 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 98.8 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 98.8 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 98.79 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 98.79 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 98.78 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.77 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 98.77 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 98.76 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.75 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 98.75 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 98.75 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 98.72 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 98.72 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.72 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.7 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 98.69 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 98.68 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 98.67 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 98.66 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 98.64 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.63 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 98.62 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 98.61 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.61 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 98.61 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 98.6 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.6 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 98.59 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 98.59 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 98.59 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 98.58 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 98.58 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.58 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 98.58 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 98.58 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 98.57 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 98.56 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 98.56 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 98.54 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 98.54 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.54 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 98.51 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.5 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 98.5 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 98.5 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 98.49 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 98.49 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 98.49 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 98.49 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 98.49 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 98.48 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 98.48 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 98.48 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 98.47 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 98.47 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 98.47 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 98.47 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 98.47 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 98.46 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 98.46 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 98.45 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 98.45 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 98.44 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 98.44 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 98.44 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 98.43 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 98.41 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 98.39 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 98.38 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.38 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 98.38 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 98.34 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 98.34 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 98.29 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 98.29 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 98.28 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 98.27 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 98.27 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 98.23 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 98.21 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 98.16 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 98.15 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 98.15 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 98.14 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 98.12 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 98.02 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 97.94 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 97.9 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 97.85 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 97.85 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 97.81 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 97.79 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 97.74 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 97.71 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 97.7 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 97.66 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 97.61 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.61 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.58 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 97.55 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 97.46 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 97.44 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.39 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 97.29 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.16 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 97.15 |
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
Probab=99.91 E-value=5.8e-25 Score=168.47 Aligned_cols=77 Identities=49% Similarity=0.843 Sum_probs=73.6
Q ss_pred CChHHHHhHHHHHhcCcccCCccccCCCceEEeccCCHHHHHHHHHHhCCcEEEEeeCCeEEEEEehHHHHHhhccC
Q psy6637 1 MSPEDQKKWEEEEMGQKVSFEQCHIDPAPFQLVERTSLLKVHSIFSLVGVNHAYVTAIGRLVGVVGLKEVRNDSHLS 77 (105)
Q Consensus 1 ~~~~e~~~we~~~l~~~idl~~~~id~sP~qv~~~tsL~kv~~LF~~Lglr~l~Vt~~GrLVGvVT~kDL~kaI~~~ 77 (105)
|+++|+++|+++++.+++||+.|.||++||||+++|||++||.||+++|++|+|||+.||||||||+|||++||++.
T Consensus 171 i~~~~~~~~~~~~l~~~Vdl~~~~md~sP~tv~~~tsL~~v~~LF~~lglr~l~V~~~GrLVGIVTrkDl~kai~~~ 247 (250)
T 2d4z_A 171 LTLEEIYRWEQREKNVVVNFETCRIDQSPFQLVEGTSLQKTHTLFSLLGLDRAYVTSMGKLVGVVALAEIQAAIEGS 247 (250)
T ss_dssp CBHHHHHHHHHHHTTCBCCTTSSCEECCSCCBCTTCBHHHHHHHHHHHTCSEEEEEETTEEEEEEEHHHHHHHHHC-
T ss_pred cChhhhhhHHHHhcCceeccccccccCCCeEECCCCcHHHHHHHHHHhCCeEEEEEECCEEEEEEEHHHHHHHHHHH
Confidence 57899999999999999999998899999999999999999999999999999999999999999999999999754
|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 105 | ||||
| d2d4za3 | 160 | d.37.1.1 (A:527-606,A:691-770) Chloride channel pr | 1e-04 |
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} Length = 160 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Chloride channel protein, CBS tandem species: Marbled electric ray (Torpedo marmorata) [TaxId: 7788]
Score = 36.6 bits (83), Expect = 1e-04
Identities = 37/70 (52%), Positives = 53/70 (75%)
Query: 1 MSPEDQKKWEEEEMGQKVSFEQCHIDPAPFQLVERTSLLKVHSIFSLVGVNHAYVTAIGR 60
++ E+ +WE+ E V+FE C ID +PFQLVE TSL K H++FSL+G++ AYVT++G+
Sbjct: 85 LTLEEIYRWEQREKNVVVNFETCRIDQSPFQLVEGTSLQKTHTLFSLLGLDRAYVTSMGK 144
Query: 61 LVGVVGLKEV 70
LVGVV L E+
Sbjct: 145 LVGVVALAEI 154
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.62 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.33 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.07 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.0 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 98.99 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 98.99 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 98.98 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 98.96 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 98.93 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 98.9 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.9 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.87 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.85 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.85 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 98.84 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.8 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 98.79 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.79 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 98.76 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 98.75 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.73 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.72 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 98.72 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.71 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 98.71 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 98.71 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 98.69 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 98.68 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 98.68 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.66 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 98.59 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 98.52 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 98.51 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.48 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.44 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.44 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 98.43 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 98.41 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 98.4 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 98.39 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 98.33 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 98.31 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.29 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.27 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 98.26 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 98.16 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 98.12 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 98.08 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.04 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 98.02 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 97.98 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.97 | |
| d1lkvx_ | 213 | FliG {Thermotoga maritima [TaxId: 2336]} | 85.28 |
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Chloride channel protein, CBS tandem species: Marbled electric ray (Torpedo marmorata) [TaxId: 7788]
Probab=99.62 E-value=8.9e-16 Score=103.60 Aligned_cols=74 Identities=50% Similarity=0.848 Sum_probs=64.9
Q ss_pred hHHHHhHHHHHhcCcccCCccccCCCceEEeccCCHHHHHHHHHHhCCcEEEEeeCCeEEEEEehHHHHHhhcc
Q psy6637 3 PEDQKKWEEEEMGQKVSFEQCHIDPAPFQLVERTSLLKVHSIFSLVGVNHAYVTAIGRLVGVVGLKEVRNDSHL 76 (105)
Q Consensus 3 ~~e~~~we~~~l~~~idl~~~~id~sP~qv~~~tsL~kv~~LF~~Lglr~l~Vt~~GrLVGvVT~kDL~kaI~~ 76 (105)
..+...++.........+....+++.|+++.+++|+.+|..+|...|+++++|+++|||+||||++||.|||++
T Consensus 87 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~tv~~~~~l~~~~~~m~~~~v~~l~V~d~g~lvGiIt~~Di~k~I~g 160 (160)
T d2d4za3 87 LEEIYRWEQREKNVVVNFETCRIDQSPFQLVEGTSLQKTHTLFSLLGLDRAYVTSMGKLVGVVALAEIQAAIEG 160 (160)
T ss_dssp HHHHHHHHHHHTTCBCCTTSSCEECCSCCBCTTCBHHHHHHHHHHHTCSEEEEEETTEEEEEEEHHHHHHHHHC
T ss_pred cchhhhhhhhhcccccceeeecccCCCEEEcCCCCHHHHHHHHHHcCCeEEEEEECCEEEEEEEHHHHHHHhCC
Confidence 34455666677776666666669999999999999999999999999999999999999999999999999965
|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1lkvx_ a.118.14.1 (X:) FliG {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|