Diaphorina citri psyllid: psy6641


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MVNMKCHNLVLPEVSEYEECRFPGAPAHSSIVFSNETLSPGTVATYACERGFELLGPSRRVCDKTGQWMPEGIPFCVRWCTGLGWET
cccCECcccccccccccccccccccccccEEEEcccccccccEEEEEcccccEECccccEEEccccccccccccCEEEccccccccc
*****CHNLVLPEVSEYEECRFPGAPAHSSIVFSNETLSPGTVATYACERGFELLGPSRRVCDKTGQWMPEGIPFCVRWCTGLGW**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNMKCHNLVLPEVSEYEECRFPGAPAHSSIVFSNETLSPGTVATYACERGFELLGPSRRVCDKTGQWMPEGIPFCVRWCTGLGWET

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HAQ, chain A
Confidence level:very confident
Coverage over the Query: 4-79
View the alignment between query and template
View the model in PyMOL