Psyllid ID: psy6641
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 87 | ||||||
| 270004842 | 860 | hypothetical protein TcasGA2_TC002984 [T | 0.839 | 0.084 | 0.689 | 2e-21 | |
| 189235259 | 750 | PREDICTED: similar to CG9095 CG9095-PB [ | 0.850 | 0.098 | 0.68 | 2e-21 | |
| 328710409 | 818 | PREDICTED: hypothetical protein LOC10016 | 0.701 | 0.074 | 0.687 | 9e-21 | |
| 195169277 | 535 | GL15201 [Drosophila persimilis] gi|19410 | 0.655 | 0.106 | 0.793 | 1e-20 | |
| 198470412 | 1122 | GA22904 [Drosophila pseudoobscura pseudo | 0.666 | 0.051 | 0.779 | 2e-20 | |
| 194894782 | 1145 | GG19416 [Drosophila erecta] gi|190649766 | 0.655 | 0.049 | 0.793 | 4e-20 | |
| 195132568 | 1122 | GI21553 [Drosophila mojavensis] gi|19390 | 0.678 | 0.052 | 0.766 | 4e-20 | |
| 161077826 | 1141 | CG9095, isoform B [Drosophila melanogast | 0.655 | 0.049 | 0.793 | 4e-20 | |
| 195478738 | 1150 | GE16067 [Drosophila yakuba] gi|194188158 | 0.655 | 0.049 | 0.793 | 4e-20 | |
| 442616393 | 968 | CG9095, isoform C [Drosophila melanogast | 0.655 | 0.058 | 0.793 | 4e-20 |
| >gi|270004842|gb|EFA01290.1| hypothetical protein TcasGA2_TC002984 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 106 bits (265), Expect = 2e-21, Method: Compositional matrix adjust.
Identities = 51/74 (68%), Positives = 57/74 (77%), Gaps = 1/74 (1%)
Query: 4 MKCHNLVLPEVSEYEECRFPGAPAHSSIVFSNETLSPGTVATYACERGFELLGPSRRVCD 63
+K L E CRFPGAPAHSS+VFS+E L PG VATY+CERGFELLGPSRRVC+
Sbjct: 20 LKSKTLAGISAEEKLGCRFPGAPAHSSVVFSDENLGPGAVATYSCERGFELLGPSRRVCE 79
Query: 64 KTGQWMPEGIPFCV 77
GQW+PEGIPFCV
Sbjct: 80 H-GQWLPEGIPFCV 92
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189235259|ref|XP_972112.2| PREDICTED: similar to CG9095 CG9095-PB [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328710409|ref|XP_001948504.2| PREDICTED: hypothetical protein LOC100160092 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|195169277|ref|XP_002025448.1| GL15201 [Drosophila persimilis] gi|194108927|gb|EDW30970.1| GL15201 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|198470412|ref|XP_002133456.1| GA22904 [Drosophila pseudoobscura pseudoobscura] gi|198145438|gb|EDY72084.1| GA22904 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|194894782|ref|XP_001978117.1| GG19416 [Drosophila erecta] gi|190649766|gb|EDV47044.1| GG19416 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195132568|ref|XP_002010715.1| GI21553 [Drosophila mojavensis] gi|193907503|gb|EDW06370.1| GI21553 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|161077826|ref|NP_001096984.1| CG9095, isoform B [Drosophila melanogaster] gi|158031821|gb|ABW09416.1| CG9095, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195478738|ref|XP_002100634.1| GE16067 [Drosophila yakuba] gi|194188158|gb|EDX01742.1| GE16067 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|442616393|ref|NP_001259562.1| CG9095, isoform C [Drosophila melanogaster] gi|440216784|gb|AGB95404.1| CG9095, isoform C [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 87 | ||||||
| FB|FBgn0030617 | 1141 | CG9095 [Drosophila melanogaste | 0.655 | 0.049 | 0.793 | 2.3e-21 | |
| UNIPROTKB|F1NE59 | 3406 | SVEP1 "Uncharacterized protein | 0.678 | 0.017 | 0.370 | 5.2e-06 | |
| RGD|2236 | 258 | C4bpb "complement component 4 | 0.701 | 0.236 | 0.363 | 5.3e-06 | |
| FB|FBgn0010114 | 958 | hig "hikaru genki" [Drosophila | 0.701 | 0.063 | 0.338 | 5.8e-06 | |
| RGD|620428 | 1236 | Cfh "complement factor H" [Rat | 0.701 | 0.049 | 0.384 | 1e-05 | |
| WB|WBGene00008314 | 868 | C54G4.4 [Caenorhabditis elegan | 0.712 | 0.071 | 0.333 | 4.5e-05 | |
| MGI|MGI:88385 | 1234 | Cfh "complement component fact | 0.678 | 0.047 | 0.4 | 6.7e-05 | |
| UNIPROTKB|F1MNH3 | 3573 | SVEP1 "Uncharacterized protein | 0.632 | 0.015 | 0.362 | 0.0001 | |
| WB|WBGene00002976 | 622 | lev-9 [Caenorhabditis elegans | 0.551 | 0.077 | 0.38 | 0.00013 | |
| UNIPROTKB|J3QLI0 | 200 | APOH "Beta-2-glycoprotein 1" [ | 0.724 | 0.315 | 0.343 | 0.00013 |
| FB|FBgn0030617 CG9095 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 263 (97.6 bits), Expect = 2.3e-21, P = 2.3e-21
Identities = 46/58 (79%), Positives = 53/58 (91%)
Query: 20 CRFPGAPAHSSIVFSNETLSPGTVATYACERGFELLGPSRRVCDKTGQWMPEGIPFCV 77
C FPG+PAHSS+VFSN L+ GTVA+Y+CERGFELLGP+RRVCDK GQW+PEGIPFCV
Sbjct: 37 CSFPGSPAHSSVVFSNANLTQGTVASYSCERGFELLGPARRVCDK-GQWVPEGIPFCV 93
|
|
| UNIPROTKB|F1NE59 SVEP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|2236 C4bpb "complement component 4 binding protein, beta" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0010114 hig "hikaru genki" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|620428 Cfh "complement factor H" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00008314 C54G4.4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:88385 Cfh "complement component factor h" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MNH3 SVEP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00002976 lev-9 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QLI0 APOH "Beta-2-glycoprotein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 87 | |||
| cd00033 | 57 | cd00033, CCP, Complement control protein (CCP) mod | 2e-12 | |
| smart00032 | 56 | smart00032, CCP, Domain abundant in complement con | 2e-12 | |
| pfam00084 | 56 | pfam00084, Sushi, Sushi domain (SCR repeat) | 9e-08 | |
| PHA02639 | 295 | PHA02639, PHA02639, EEV host range protein; Provis | 1e-05 | |
| PHA02817 | 225 | PHA02817, PHA02817, EEV Host range protein; Provis | 2e-04 | |
| PHA02831 | 268 | PHA02831, PHA02831, EEV host range protein; Provis | 2e-04 |
| >gnl|CDD|153056 cd00033, CCP, Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system | Back alignment and domain information |
|---|
Score = 56.3 bits (136), Expect = 2e-12
Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 1/58 (1%)
Query: 20 CRFPGAPAHSSIVFSNETLSPGTVATYACERGFELLGPSRRVCDKTGQWMPEGIPFCV 77
C P P + ++ S + S G+ TY+C G+ L+G S C + G W P P C
Sbjct: 1 CPPPPVPENGTVTGSKGSYSYGSTVTYSCNEGYTLVGSSTITCTENGGWSPP-PPTCE 57
|
SUSHI repeats (short complement-like repeat, SCR) are abundant in complement control proteins. The complement control protein (CCP) modules (also known as short consensus repeats SCRs or SUSHI repeats) contain approximately 60 amino acid residues and have been identified in several proteins of the complement system. Typically, 2 to 4 modules contribute to a binding site, implying that the orientation of the modules to each other is critical for function. Length = 57 |
| >gnl|CDD|214478 smart00032, CCP, Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) | Back alignment and domain information |
|---|
| >gnl|CDD|215703 pfam00084, Sushi, Sushi domain (SCR repeat) | Back alignment and domain information |
|---|
| >gnl|CDD|165022 PHA02639, PHA02639, EEV host range protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165167 PHA02817, PHA02817, EEV Host range protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165176 PHA02831, PHA02831, EEV host range protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| PHA02817 | 225 | EEV Host range protein; Provisional | 99.77 | |
| PHA02831 | 268 | EEV host range protein; Provisional | 99.76 | |
| PHA02639 | 295 | EEV host range protein; Provisional | 99.73 | |
| PHA02831 | 268 | EEV host range protein; Provisional | 99.72 | |
| cd00033 | 57 | CCP Complement control protein (CCP) modules (aka | 99.71 | |
| PHA02927 | 263 | secreted complement-binding protein; Provisional | 99.69 | |
| smart00032 | 57 | CCP Domain abundant in complement control proteins | 99.69 | |
| PHA02639 | 295 | EEV host range protein; Provisional | 99.67 | |
| PF00084 | 56 | Sushi: Sushi domain (SCR repeat); InterPro: IPR000 | 99.67 | |
| PHA02927 | 263 | secreted complement-binding protein; Provisional | 99.63 | |
| PHA02817 | 225 | EEV Host range protein; Provisional | 99.58 | |
| PHA02954 | 317 | EEV membrane glycoprotein; Provisional | 99.54 | |
| PHA02954 | 317 | EEV membrane glycoprotein; Provisional | 99.48 | |
| smart00008 | 70 | HormR Domain present in hormone receptors. | 94.37 | |
| PF02793 | 66 | HRM: Hormone receptor domain; InterPro: IPR001879 | 92.11 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 84.28 | |
| KOG4564|consensus | 473 | 82.42 |
| >PHA02817 EEV Host range protein; Provisional | Back alignment and domain information |
|---|
Probab=99.77 E-value=2.9e-18 Score=106.01 Aligned_cols=76 Identities=25% Similarity=0.591 Sum_probs=65.4
Q ss_pred eeEEc--ceecCCCC--CcccCCCCCCCCCeEEEe--cCCCcCCCCEEEEEcCCCCEEcCCCceeeCCCCccCCCCCCeE
Q psy6641 3 NMKCH--NLVLPEVS--EYEECRFPGAPAHSSIVF--SNETLSPGTVATYACERGFELLGPSRRVCDKTGQWMPEGIPFC 76 (87)
Q Consensus 3 ~~~C~--g~W~~~~~--~~~~C~~p~~~~~g~~~~--~~~~~~~g~~~~~~C~~gy~l~G~~~~~C~~~g~Ws~~~~p~C 76 (87)
.++|+ |+|++..| +.+.|+.|. +.||.+.. ....|.+|++|+|+|++||.|.|+..++|+++|+|+++ .|.|
T Consensus 68 ~i~C~~dG~Ws~~~P~C~~v~C~~P~-i~NG~v~~~~~~~~y~yg~~Vty~C~~Gy~L~G~~~~tC~~~G~WSp~-~P~C 145 (225)
T PHA02817 68 NIICEKDGKWNKEFPVCKIIRCRFPA-LQNGFVNGIPDSKKFYYESEVSFSCKPGFVLIGTKYSVCGINSSWIPK-VPIC 145 (225)
T ss_pred eEEECCCCcCCCCCCeeeeeECCCCC-CcCceeEccccCCceEcCCEEEEEcCCCCEEcCCCceEECCCCeECCC-CCEe
Confidence 57998 89998777 567999875 67998763 34678899999999999999999999999999999997 9999
Q ss_pred eecc
Q psy6641 77 VRWC 80 (87)
Q Consensus 77 ~~~~ 80 (87)
.+..
T Consensus 146 ~~~~ 149 (225)
T PHA02817 146 SRDN 149 (225)
T ss_pred ecCC
Confidence 8754
|
|
| >PHA02831 EEV host range protein; Provisional | Back alignment and domain information |
|---|
| >PHA02639 EEV host range protein; Provisional | Back alignment and domain information |
|---|
| >PHA02831 EEV host range protein; Provisional | Back alignment and domain information |
|---|
| >cd00033 CCP Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system | Back alignment and domain information |
|---|
| >PHA02927 secreted complement-binding protein; Provisional | Back alignment and domain information |
|---|
| >smart00032 CCP Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) | Back alignment and domain information |
|---|
| >PHA02639 EEV host range protein; Provisional | Back alignment and domain information |
|---|
| >PF00084 Sushi: Sushi domain (SCR repeat); InterPro: IPR000436 Sushi domains are also known as Complement control protein (CCP) modules, or short consensus repeats (SCR), exist in a wide variety of complement and adhesion proteins | Back alignment and domain information |
|---|
| >PHA02927 secreted complement-binding protein; Provisional | Back alignment and domain information |
|---|
| >PHA02817 EEV Host range protein; Provisional | Back alignment and domain information |
|---|
| >PHA02954 EEV membrane glycoprotein; Provisional | Back alignment and domain information |
|---|
| >PHA02954 EEV membrane glycoprotein; Provisional | Back alignment and domain information |
|---|
| >smart00008 HormR Domain present in hormone receptors | Back alignment and domain information |
|---|
| >PF02793 HRM: Hormone receptor domain; InterPro: IPR001879 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >KOG4564|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 87 | |||
| 2yra_A | 74 | Seizure 6-like protein isoform 3; disulfide bond, | 2e-11 | |
| 1ly2_A | 130 | CD21, complement receptor type 2; epstein BARR vir | 3e-11 | |
| 1ly2_A | 130 | CD21, complement receptor type 2; epstein BARR vir | 3e-09 | |
| 2ehf_A | 73 | CUB and sushi domain-containing protein 1; CUB and | 7e-11 | |
| 1rid_A | 244 | Complement control protein; regulation, SCR, immun | 7e-10 | |
| 1rid_A | 244 | Complement control protein; regulation, SCR, immun | 1e-07 | |
| 1rid_A | 244 | Complement control protein; regulation, SCR, immun | 2e-06 | |
| 1rid_A | 244 | Complement control protein; regulation, SCR, immun | 2e-06 | |
| 3o8e_B | 252 | Membrane cofactor protein; short consensus repeat, | 7e-10 | |
| 3o8e_B | 252 | Membrane cofactor protein; short consensus repeat, | 1e-08 | |
| 3o8e_B | 252 | Membrane cofactor protein; short consensus repeat, | 2e-08 | |
| 3o8e_B | 252 | Membrane cofactor protein; short consensus repeat, | 4e-06 | |
| 1qub_A | 319 | Protein (human BETA2-glycoprotein I); short consen | 1e-09 | |
| 1qub_A | 319 | Protein (human BETA2-glycoprotein I); short consen | 2e-08 | |
| 1qub_A | 319 | Protein (human BETA2-glycoprotein I); short consen | 3e-08 | |
| 1qub_A | 319 | Protein (human BETA2-glycoprotein I); short consen | 4e-07 | |
| 3erb_A | 223 | Complement C2; C3/C5 convertase, short consensus r | 2e-09 | |
| 3erb_A | 223 | Complement C2; C3/C5 convertase, short consensus r | 4e-08 | |
| 3erb_A | 223 | Complement C2; C3/C5 convertase, short consensus r | 4e-06 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 4e-09 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 2e-08 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 3e-08 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 7e-08 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 1e-07 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 2e-07 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 2e-07 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 4e-07 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 1e-06 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 3e-05 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 1e-04 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 7e-09 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 7e-09 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 1e-06 | |
| 1h03_P | 125 | Complement decay-accelerating factor; immune syste | 8e-09 | |
| 1h03_P | 125 | Complement decay-accelerating factor; immune syste | 5e-08 | |
| 1ntl_A | 551 | CRRY-IG; immunology, complement, glycoprotein, SCR | 9e-09 | |
| 1ntl_A | 551 | CRRY-IG; immunology, complement, glycoprotein, SCR | 1e-06 | |
| 1ntl_A | 551 | CRRY-IG; immunology, complement, glycoprotein, SCR | 5e-06 | |
| 1ntl_A | 551 | CRRY-IG; immunology, complement, glycoprotein, SCR | 2e-05 | |
| 1ntl_A | 551 | CRRY-IG; immunology, complement, glycoprotein, SCR | 3e-04 | |
| 2xrb_A | 290 | Complement regulatory protein CRRY; immune system, | 2e-08 | |
| 2xrb_A | 290 | Complement regulatory protein CRRY; immune system, | 2e-06 | |
| 2xrb_A | 290 | Complement regulatory protein CRRY; immune system, | 6e-06 | |
| 1ok3_A | 254 | CD55, CR, DAF, complement decay-accelerating facto | 3e-08 | |
| 1ok3_A | 254 | CD55, CR, DAF, complement decay-accelerating facto | 4e-07 | |
| 1ok3_A | 254 | CD55, CR, DAF, complement decay-accelerating facto | 6e-06 | |
| 1ok3_A | 254 | CD55, CR, DAF, complement decay-accelerating facto | 2e-05 | |
| 3gov_A | 155 | MAsp-1; complement, serine protease, beta barrel, | 3e-08 | |
| 3gov_A | 155 | MAsp-1; complement, serine protease, beta barrel, | 5e-07 | |
| 3iyp_F | 381 | Complement decay-accelerating factor; virus, recep | 4e-08 | |
| 3iyp_F | 381 | Complement decay-accelerating factor; virus, recep | 2e-06 | |
| 3iyp_F | 381 | Complement decay-accelerating factor; virus, recep | 3e-05 | |
| 3iyp_F | 381 | Complement decay-accelerating factor; virus, recep | 7e-05 | |
| 2wii_C | 277 | H factor 1, complement factor H; immune system, su | 5e-08 | |
| 2wii_C | 277 | H factor 1, complement factor H; immune system, su | 5e-08 | |
| 2wii_C | 277 | H factor 1, complement factor H; immune system, su | 8e-08 | |
| 2wii_C | 277 | H factor 1, complement factor H; immune system, su | 5e-06 | |
| 2c8i_E | 316 | CD55, complement decay-accelerating factor; picorn | 5e-08 | |
| 2c8i_E | 316 | CD55, complement decay-accelerating factor; picorn | 2e-06 | |
| 2c8i_E | 316 | CD55, complement decay-accelerating factor; picorn | 2e-06 | |
| 2c8i_E | 316 | CD55, complement decay-accelerating factor; picorn | 2e-05 | |
| 2c8i_E | 316 | CD55, complement decay-accelerating factor; picorn | 1e-04 | |
| 1ntj_A | 320 | Complement receptor related protein; immunology, g | 8e-08 | |
| 1ntj_A | 320 | Complement receptor related protein; immunology, g | 4e-06 | |
| 1ntj_A | 320 | Complement receptor related protein; immunology, g | 2e-05 | |
| 1ntj_A | 320 | Complement receptor related protein; immunology, g | 3e-05 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 3e-07 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 7e-07 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 2e-06 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 7e-06 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 8e-06 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 2e-05 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 2e-05 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 2e-05 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 4e-05 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 6e-05 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 7e-05 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 8e-05 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 1e-04 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 2e-04 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 5e-04 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 6e-04 | |
| 1gkg_A | 136 | Complement receptor type 1; module, SCR, structure | 3e-07 | |
| 1gkg_A | 136 | Complement receptor type 1; module, SCR, structure | 4e-05 | |
| 3r62_A | 129 | H factor 1, complement factor H; immunity, repeati | 4e-07 | |
| 3r62_A | 129 | H factor 1, complement factor H; immunity, repeati | 5e-05 | |
| 2aty_A | 376 | Complement receptor chimeric conjugate CR2-IG; imm | 5e-07 | |
| 2aty_A | 376 | Complement receptor chimeric conjugate CR2-IG; imm | 8e-07 | |
| 3sw0_X | 188 | H factor 1, complement factor H; innate immune res | 5e-07 | |
| 3sw0_X | 188 | H factor 1, complement factor H; innate immune res | 4e-06 | |
| 3sw0_X | 188 | H factor 1, complement factor H; innate immune res | 4e-06 | |
| 2uwn_A | 187 | H factor 1, human complement factor H; alternative | 5e-07 | |
| 2uwn_A | 187 | H factor 1, human complement factor H; alternative | 1e-04 | |
| 1gkn_A | 128 | Complement receptor type 1; module, SCR, structure | 6e-07 | |
| 1gkn_A | 128 | Complement receptor type 1; module, SCR, structure | 1e-06 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 8e-07 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 3e-06 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 3e-06 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 4e-06 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 5e-06 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 9e-06 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 1e-05 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 1e-05 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 2e-05 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 3e-05 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 4e-05 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 5e-05 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 9e-05 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 6e-04 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 8e-04 | |
| 2a55_A | 133 | C4B-binding protein; complement, SCR, CCP module, | 1e-06 | |
| 2a55_A | 133 | C4B-binding protein; complement, SCR, CCP module, | 1e-06 | |
| 2qy0_A | 159 | Complement C1R subcomponent; serine protease, beta | 3e-06 | |
| 2yby_A | 124 | Complement factor H; immune system, complement reg | 2e-05 | |
| 3tvj_A | 86 | Mannan-binding lectin serine protease 2 A chain; i | 2e-04 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 2e-04 |
| >2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
Score = 53.2 bits (128), Expect = 2e-11
Identities = 15/64 (23%), Positives = 24/64 (37%), Gaps = 1/64 (1%)
Query: 15 SEYEECRFPGAPAHSSIVFSNETLSPGTVATYACERGFELLGPSRRVCDKTGQWMPEGIP 74
S C + S+ L G TY C+ G++++G C W + P
Sbjct: 3 SGSSGCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIVGSDTLTCQWDLSWSSD-PP 61
Query: 75 FCVR 78
FC +
Sbjct: 62 FCEK 65
|
| >1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 | Back alignment and structure |
|---|
| >1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Length = 130 | Back alignment and structure |
|---|
| >2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 | Back alignment and structure |
|---|
| >1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 | Back alignment and structure |
|---|
| >1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 | Back alignment and structure |
|---|
| >1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A Length = 244 | Back alignment and structure |
|---|
| >3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 | Back alignment and structure |
|---|
| >3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 | Back alignment and structure |
|---|
| >3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 | Back alignment and structure |
|---|
| >3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Length = 252 | Back alignment and structure |
|---|
| >1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 | Back alignment and structure |
|---|
| >1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 | Back alignment and structure |
|---|
| >1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 | Back alignment and structure |
|---|
| >1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Length = 319 | Back alignment and structure |
|---|
| >3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 | Back alignment and structure |
|---|
| >3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 | Back alignment and structure |
|---|
| >3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Length = 223 | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} Length = 951 | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 | Back alignment and structure |
|---|
| >1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 | Back alignment and structure |
|---|
| >1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A Length = 125 | Back alignment and structure |
|---|
| >1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 | Back alignment and structure |
|---|
| >1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 | Back alignment and structure |
|---|
| >1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 | Back alignment and structure |
|---|
| >1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 | Back alignment and structure |
|---|
| >1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Length = 551 | Back alignment and structure |
|---|
| >2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 | Back alignment and structure |
|---|
| >2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 | Back alignment and structure |
|---|
| >2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A Length = 290 | Back alignment and structure |
|---|
| >1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 | Back alignment and structure |
|---|
| >1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 | Back alignment and structure |
|---|
| >1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 | Back alignment and structure |
|---|
| >1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Length = 254 | Back alignment and structure |
|---|
| >3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 | Back alignment and structure |
|---|
| >3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Length = 155 | Back alignment and structure |
|---|
| >3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 | Back alignment and structure |
|---|
| >3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 | Back alignment and structure |
|---|
| >3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 | Back alignment and structure |
|---|
| >3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} Length = 381 | Back alignment and structure |
|---|
| >2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 | Back alignment and structure |
|---|
| >2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 | Back alignment and structure |
|---|
| >2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 | Back alignment and structure |
|---|
| >2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A Length = 277 | Back alignment and structure |
|---|
| >2c8i_E CD55, complement decay-accelerating factor; picornavirus, DAF, virus-receptor complex, antigen, blood group antigen, complement pathway, GPI-anchor; 14.00A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 Length = 316 | Back alignment and structure |
|---|
| >1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 | Back alignment and structure |
|---|
| >1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 | Back alignment and structure |
|---|
| >1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 | Back alignment and structure |
|---|
| >1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} Length = 320 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A Length = 1213 | Back alignment and structure |
|---|
| >1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 | Back alignment and structure |
|---|
| >1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Length = 136 | Back alignment and structure |
|---|
| >3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 | Back alignment and structure |
|---|
| >3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Length = 129 | Back alignment and structure |
|---|
| >2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Length = 376 | Back alignment and structure |
|---|
| >3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 | Back alignment and structure |
|---|
| >2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A Length = 187 | Back alignment and structure |
|---|
| >1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 | Back alignment and structure |
|---|
| >1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Length = 128 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} Length = 1931 | Back alignment and structure |
|---|
| >2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Length = 133 | Back alignment and structure |
|---|
| >2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Length = 159 | Back alignment and structure |
|---|
| >2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} Length = 124 | Back alignment and structure |
|---|
| >3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 86 | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Length = 913 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| 2ehf_A | 73 | CUB and sushi domain-containing protein 1; CUB and | 99.84 | |
| 1gkn_A | 128 | Complement receptor type 1; module, SCR, structure | 99.8 | |
| 2yra_A | 74 | Seizure 6-like protein isoform 3; disulfide bond, | 99.8 | |
| 1h03_P | 125 | Complement decay-accelerating factor; immune syste | 99.79 | |
| 3gov_A | 155 | MAsp-1; complement, serine protease, beta barrel, | 99.78 | |
| 1gkg_A | 136 | Complement receptor type 1; module, SCR, structure | 99.75 | |
| 1srz_A | 68 | Gamma-aminobutyric acid type B receptor, subunit 1 | 99.74 | |
| 2qy0_A | 159 | Complement C1R subcomponent; serine protease, beta | 99.74 | |
| 2a55_A | 133 | C4B-binding protein; complement, SCR, CCP module, | 99.73 | |
| 3erb_A | 223 | Complement C2; C3/C5 convertase, short consensus r | 99.73 | |
| 3iyp_F | 381 | Complement decay-accelerating factor; virus, recep | 99.72 | |
| 3o8e_B | 252 | Membrane cofactor protein; short consensus repeat, | 99.72 | |
| 1ok3_A | 254 | CD55, CR, DAF, complement decay-accelerating facto | 99.71 | |
| 3tvj_A | 86 | Mannan-binding lectin serine protease 2 A chain; i | 99.71 | |
| 1ly2_A | 130 | CD21, complement receptor type 2; epstein BARR vir | 99.7 | |
| 2wii_C | 277 | H factor 1, complement factor H; immune system, su | 99.69 | |
| 3erb_A | 223 | Complement C2; C3/C5 convertase, short consensus r | 99.69 | |
| 2c8i_E | 316 | CD55, complement decay-accelerating factor; picorn | 99.69 | |
| 3sw0_X | 188 | H factor 1, complement factor H; innate immune res | 99.69 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 99.68 | |
| 1qub_A | 319 | Protein (human BETA2-glycoprotein I); short consen | 99.68 | |
| 1ok3_A | 254 | CD55, CR, DAF, complement decay-accelerating facto | 99.68 | |
| 3o8e_B | 252 | Membrane cofactor protein; short consensus repeat, | 99.67 | |
| 2xrb_A | 290 | Complement regulatory protein CRRY; immune system, | 99.67 | |
| 1ly2_A | 130 | CD21, complement receptor type 2; epstein BARR vir | 99.66 | |
| 1qub_A | 319 | Protein (human BETA2-glycoprotein I); short consen | 99.66 | |
| 3gov_A | 155 | MAsp-1; complement, serine protease, beta barrel, | 99.65 | |
| 2c8i_E | 316 | CD55, complement decay-accelerating factor; picorn | 99.65 | |
| 2wii_C | 277 | H factor 1, complement factor H; immune system, su | 99.65 | |
| 1rid_A | 244 | Complement control protein; regulation, SCR, immun | 99.63 | |
| 4ayi_A | 125 | H factor 1, complement factor H; immune system, an | 99.63 | |
| 1gkg_A | 136 | Complement receptor type 1; module, SCR, structure | 99.62 | |
| 3iyp_F | 381 | Complement decay-accelerating factor; virus, recep | 99.62 | |
| 1ntj_A | 320 | Complement receptor related protein; immunology, g | 99.62 | |
| 3r62_A | 129 | H factor 1, complement factor H; immunity, repeati | 99.62 | |
| 1rid_A | 244 | Complement control protein; regulation, SCR, immun | 99.61 | |
| 2aty_A | 376 | Complement receptor chimeric conjugate CR2-IG; imm | 99.61 | |
| 2xrb_A | 290 | Complement regulatory protein CRRY; immune system, | 99.61 | |
| 1gkn_A | 128 | Complement receptor type 1; module, SCR, structure | 99.61 | |
| 1h03_P | 125 | Complement decay-accelerating factor; immune syste | 99.6 | |
| 2yby_A | 124 | Complement factor H; immune system, complement reg | 99.6 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 99.58 | |
| 2qy0_A | 159 | Complement C1R subcomponent; serine protease, beta | 99.58 | |
| 1ntj_A | 320 | Complement receptor related protein; immunology, g | 99.58 | |
| 1ntl_A | 551 | CRRY-IG; immunology, complement, glycoprotein, SCR | 99.57 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 99.56 | |
| 2uwn_A | 187 | H factor 1, human complement factor H; alternative | 99.56 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 99.56 | |
| 2aty_A | 376 | Complement receptor chimeric conjugate CR2-IG; imm | 99.55 | |
| 3r62_A | 129 | H factor 1, complement factor H; immunity, repeati | 99.55 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 99.54 | |
| 2uwn_A | 187 | H factor 1, human complement factor H; alternative | 99.53 | |
| 3sw0_X | 188 | H factor 1, complement factor H; innate immune res | 99.53 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 99.52 | |
| 1ntl_A | 551 | CRRY-IG; immunology, complement, glycoprotein, SCR | 99.51 | |
| 2a55_A | 133 | C4B-binding protein; complement, SCR, CCP module, | 99.49 | |
| 2gsx_A | 951 | Complement receptor type 2; SCR domain, CCP domain | 99.47 | |
| 1haq_A | 1213 | Complement factor H; immunology, glycoprotein, com | 99.44 | |
| 1zjk_A | 403 | Mannan-binding lectin serine protease 2; beta barr | 99.44 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 99.43 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 99.42 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 99.41 | |
| 2q7z_A | 1931 | Complement receptor type 1; SCR domain, blood grou | 99.4 | |
| 2yby_A | 124 | Complement factor H; immune system, complement reg | 99.36 | |
| 2b5i_D | 217 | Interleukin-2 receptor alpha chain; four-helix bun | 99.31 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 99.3 | |
| 4ayi_A | 125 | H factor 1, complement factor H; immune system, an | 99.2 | |
| 2psm_F | 78 | Interleukin-15 receptor alpha chain; cytokine, gly | 99.17 | |
| 1gpz_A | 399 | Complement C1R component; hydrolase, activation, i | 99.1 | |
| 2z3q_B | 107 | Interleukin-15 receptor alpha chain; protein-prote | 98.81 | |
| 1elv_A | 333 | Complement C1S component; trypsin-like serin prote | 98.76 | |
| 2b5i_D | 217 | Interleukin-2 receptor alpha chain; four-helix bun | 98.7 | |
| 4f4o_C | 347 | Haptoglobin; globin fold, serine protease fold, co | 98.22 | |
| 1md8_A | 329 | C1R complement serine protease; innate immunity, a | 98.0 | |
| 4aqb_A | 361 | Mannan-binding lectin serine protease 1; blood clo | 95.61 | |
| 2yra_A | 74 | Seizure 6-like protein isoform 3; disulfide bond, | 94.55 | |
| 3n7s_A | 115 | Calcitonin gene-related peptide type 1 receptor; G | 90.79 | |
| 1u34_A | 119 | CRFR2B, corticotropin releasing factor receptor 2; | 88.22 | |
| 4ers_A | 96 | GL-R, glucagon receptor; class-B GPCR, FAB, glycos | 88.1 | |
| 2l27_A | 84 | Seven transmembrane helix receptor; CRF, ECD1, fam | 87.63 | |
| 3c5t_A | 122 | Glucagon-like peptide 1 receptor; ligand-bound G p | 86.67 | |
| 2jod_A | 106 | Pituitary adenylate cyclase-activating polypeptide | 86.37 | |
| 2x57_A | 116 | Vasoactive intestinal polypeptide receptor 2; G-pr | 86.17 | |
| 2qkh_A | 135 | Glucose-dependent insulinotropic polypeptide recep | 85.7 | |
| 2xdg_A | 92 | Growth hormone-releasing hormone receptor; signali | 80.62 |
| >2ehf_A CUB and sushi domain-containing protein 1; CUB and sushi multiple domains protein 1, CSMD1, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.84 E-value=1.2e-20 Score=98.19 Aligned_cols=69 Identities=26% Similarity=0.434 Sum_probs=62.1
Q ss_pred eecCCCC--CcccCCCCCCCCCeEEEecCCCcCCCCEEEEEcCCCCEEcCCCceeeCCCCccCCCCCCeEeecc
Q psy6641 9 LVLPEVS--EYEECRFPGAPAHSSIVFSNETLSPGTVATYACERGFELLGPSRRVCDKTGQWMPEGIPFCVRWC 80 (87)
Q Consensus 9 ~W~~~~~--~~~~C~~p~~~~~g~~~~~~~~~~~g~~~~~~C~~gy~l~G~~~~~C~~~g~Ws~~~~p~C~~~~ 80 (87)
.|+...| +.+.|+.|+.+.||.+.. ..|.+|++|+|+|++||.|.|+..++|+++|+|+.+ .|.|++.+
T Consensus 1 Gws~~~p~C~~~~C~~p~~p~nG~~~~--~~~~~g~~v~f~C~~Gy~L~G~~~~~C~~~g~Ws~~-~P~C~~~c 71 (73)
T 2ehf_A 1 GSSGSSGEIEKGGCGDPGIPAYGKRTG--SSFLHGDTLTFECPAAFELVGERVITCQQNNQWSGN-KPSCSGPS 71 (73)
T ss_dssp CCCCCCCCCCCCCSCCCCCCSSSEEEC--SCCCTTCEEEEECCSSCCBCSCSEEEBCSSSSBSSC-CCCBCCCC
T ss_pred CCCCCCCeEeeeECcCCCCCCCCEEeC--CcccCCCEEEEEcCCCCEEeCCCeEEECCCCeECCC-CCeEeccc
Confidence 3888877 688999999999999873 578899999999999999999999999999999997 99998765
|
| >1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A | Back alignment and structure |
|---|
| >3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A | Back alignment and structure |
|---|
| >1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A | Back alignment and structure |
|---|
| >1srz_A Gamma-aminobutyric acid type B receptor, subunit 1; GABA(B) receptor, CIS-trans isomerization, CCP module, sushi domain; NMR {Rattus norvegicus} SCOP: g.18.1.1 PDB: 1ss2_A | Back alignment and structure |
|---|
| >2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* | Back alignment and structure |
|---|
| >1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A | Back alignment and structure |
|---|
| >3tvj_A Mannan-binding lectin serine protease 2 A chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} | Back alignment and structure |
|---|
| >1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C | Back alignment and structure |
|---|
| >2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A | Back alignment and structure |
|---|
| >3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A | Back alignment and structure |
|---|
| >1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A | Back alignment and structure |
|---|
| >3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* | Back alignment and structure |
|---|
| >2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A | Back alignment and structure |
|---|
| >1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C | Back alignment and structure |
|---|
| >1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A | Back alignment and structure |
|---|
| >3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A | Back alignment and structure |
|---|
| >2wii_C H factor 1, complement factor H; immune system, sushi, secreted, polymorphism, glycoprotein, complement system, complement pathway, immune response; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2rlp_A 2rlq_A | Back alignment and structure |
|---|
| >1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A | Back alignment and structure |
|---|
| >4ayi_A H factor 1, complement factor H; immune system, antigens; 2.31A {Homo sapiens} PDB: 4aye_A 4ayd_A 4aym_A 2w80_A 2w81_A 2jgw_A 2jgx_A | Back alignment and structure |
|---|
| >1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A | Back alignment and structure |
|---|
| >3iyp_F Complement decay-accelerating factor; virus, receptor, complex, echovirus, DAF, icosahedral virus; HET: DAO; 7.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C | Back alignment and structure |
|---|
| >1rid_A Complement control protein; regulation, SCR, immune system; HET: IDS SGN; 2.10A {Vaccinia virus} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1g44_A 1g40_A* 1y8e_A* 1e5g_A 1vvc_A 1vvd_A 1vve_A | Back alignment and structure |
|---|
| >2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xrb_A Complement regulatory protein CRRY; immune system, immunology; 2.50A {Rattus norvegicus} PDB: 2xrd_A | Back alignment and structure |
|---|
| >1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >1h03_P Complement decay-accelerating factor; immune system protein, enteroviral receptor, bacterial receptor, ligand for CD97, complement pathway; 1.7A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1h2q_P 1uot_P 1upn_E 1h2p_P 1h04_P 2qzd_A | Back alignment and structure |
|---|
| >2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1ntj_A Complement receptor related protein; immunology, glycoprotein, SCR, CCP, immune system; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A | Back alignment and structure |
|---|
| >2uwn_A H factor 1, human complement factor H; alternative splicing, sucrose octasulphate, AGE-related macular degeneration, complement alternate pathway; HET: SCR; 2.35A {Homo sapiens} PDB: 2v8e_A* 2ic4_A 2w80_A 2w81_A 2jgw_A 2jgx_A | Back alignment and structure |
|---|
| >3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gsx_A Complement receptor type 2; SCR domain, CCP domain, sushi domain, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1haq_A Complement factor H; immunology, glycoprotein, complement alternate pathway, SCR, CCP; NMR {Homo sapiens} PDB: 3gau_A 3gav_A 3gaw_A 2qfh_A 2qfg_A 1hfh_A 2kms_A 1hfi_A 1hcc_A | Back alignment and structure |
|---|
| >1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >2q7z_A Complement receptor type 1; SCR domain, blood group antigen, complement pathway, glycoprotein, immune response, innate immunity, membrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yby_A Complement factor H; immune system, complement regulation, innate immunity, infec; 1.58A {Mus musculus} | Back alignment and structure |
|---|
| >2b5i_D Interleukin-2 receptor alpha chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 3nfp_I 3iu3_I 1z92_B 2erj_A* | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4ayi_A H factor 1, complement factor H; immune system, antigens; 2.31A {Homo sapiens} PDB: 4aye_A 4ayd_A 4aym_A 2w80_A 2w81_A 2jgw_A 2jgx_A | Back alignment and structure |
|---|
| >2psm_F Interleukin-15 receptor alpha chain; cytokine, glycoprotein, secreted, alternative splicing, endoplasmic reticulum, golgi apparatus, membrane; 2.19A {Mus musculus} SCOP: g.18.1.1 | Back alignment and structure |
|---|
| >1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >2z3q_B Interleukin-15 receptor alpha chain; protein-protein complex, cytokine/cytokine receptor complex; 1.85A {Homo sapiens} SCOP: g.18.1.1 PDB: 2z3r_B 2ers_A | Back alignment and structure |
|---|
| >1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 | Back alignment and structure |
|---|
| >2b5i_D Interleukin-2 receptor alpha chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 3nfp_I 3iu3_I 1z92_B 2erj_A* | Back alignment and structure |
|---|
| >4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} | Back alignment and structure |
|---|
| >1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* | Back alignment and structure |
|---|
| >4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2yra_A Seizure 6-like protein isoform 3; disulfide bond, sushi domain, SCR, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n7s_A Calcitonin gene-related peptide type 1 receptor; GPCR, class B GPCR, antagonist, olcegepant, telcagepant, MIG membrane protein; HET: 3N6 3N7; 2.10A {Homo sapiens} PDB: 3n7r_A* 3n7p_A* 3aqf_B | Back alignment and structure |
|---|
| >1u34_A CRFR2B, corticotropin releasing factor receptor 2; beta sheets and loops, signaling protein; NMR {Mus musculus} SCOP: g.76.1.1 PDB: 2jnd_A* 2jnc_A | Back alignment and structure |
|---|
| >4ers_A GL-R, glucagon receptor; class-B GPCR, FAB, glycosylation, extra-C immune system; HET: NAG; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >2l27_A Seven transmembrane helix receptor; CRF, ECD1, family B1, alpha helical CRF, membrane P peptide binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3c5t_A Glucagon-like peptide 1 receptor; ligand-bound G protein-coupled receptor extracellular domain protein coupled receptor, glycoprotein, membrane; HET: 10M; 2.10A {Homo sapiens} PDB: 3c59_A* 3iol_A* | Back alignment and structure |
|---|
| >2jod_A Pituitary adenylate cyclase-activating polypeptide type I receptor; protein/peptide complex, signaling protein; NMR {Homo sapiens} SCOP: g.76.1.1 | Back alignment and structure |
|---|
| >2x57_A Vasoactive intestinal polypeptide receptor 2; G-protein coupled receptor, circadian rhythm, MALE reproduct hormone binding, growth, transducer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2qkh_A Glucose-dependent insulinotropic polypeptide receptor; GPCR, incretin, hormone-GPCR complex, extracellular domain, ligand binding domain, ECD; HET: QKH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2xdg_A Growth hormone-releasing hormone receptor; signaling protein, membrane protein; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 87 | ||||
| d2ok5a3 | 61 | g.18.1.1 (A:77-137) Complement factor B {Human (Ho | 4e-11 | |
| d1ly2a2 | 63 | g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Hu | 4e-11 | |
| d2ok5a2 | 62 | g.18.1.1 (A:138-199) Complement factor B {Human (H | 6e-10 | |
| d2o39c2 | 64 | g.18.1.1 (C:63-126) CD46 (membrane cofactor protei | 1e-09 | |
| d1hcca_ | 59 | g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum | 2e-09 | |
| d1h03p2 | 63 | g.18.1.1 (P:67-129) Complement decay-accelerating | 2e-09 | |
| d1g40a4 | 59 | g.18.1.1 (A:185-243) Complement control protein {V | 2e-09 | |
| d1quba4 | 60 | g.18.1.1 (A:184-243) beta2-glycoprotein I {Human ( | 3e-09 | |
| d1g40a3 | 58 | g.18.1.1 (A:127-184) Complement control protein {V | 6e-09 | |
| d1quba2 | 58 | g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (H | 8e-09 | |
| d1quba3 | 63 | g.18.1.1 (A:121-183) beta2-glycoprotein I {Human ( | 2e-08 | |
| d1ly2a1 | 67 | g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Huma | 5e-08 | |
| d1h03p1 | 62 | g.18.1.1 (P:5-66) Complement decay-accelerating fa | 7e-08 | |
| d1g40a2 | 62 | g.18.1.1 (A:65-126) Complement control protein {Va | 2e-07 | |
| d1quba1 | 62 | g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Hom | 2e-07 | |
| d1hfia_ | 62 | g.18.1.1 (A:) Factor H, 15th and 16th modules {Hum | 3e-07 | |
| d2o39c1 | 62 | g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, | 4e-07 | |
| d1ppqa_ | 68 | g.18.1.1 (A:) Complement receptor 1, cr1 {Human (H | 5e-07 | |
| d1srza_ | 68 | g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norve | 2e-05 | |
| d1ok3a2 | 64 | g.18.1.1 (A:65-128) Complement decay-accelerating | 3e-05 | |
| d1gkga2 | 70 | g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 | 9e-05 | |
| d1elva2 | 68 | g.18.1.1 (A:342-409) Complement C1S protease domai | 1e-04 | |
| d1gpza2 | 68 | g.18.1.1 (A:290-357) Complement C1R protease domai | 2e-04 | |
| d1gkna1 | 64 | g.18.1.1 (A:897-960) Complement receptor 1, cr1 {H | 4e-04 | |
| d1q3xa2 | 75 | g.18.1.1 (A:366-440) Mannan-binding lectin serine | 7e-04 | |
| d2ok5a4 | 68 | g.18.1.1 (A:9-76) Complement factor B {Human (Homo | 0.004 |
| >d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
class: Small proteins fold: Complement control module/SCR domain superfamily: Complement control module/SCR domain family: Complement control module/SCR domain domain: Complement factor B species: Human (Homo sapiens) [TaxId: 9606]
Score = 51.1 bits (122), Expect = 4e-11
Identities = 11/57 (19%), Positives = 20/57 (35%), Gaps = 1/57 (1%)
Query: 20 CRFPGAPAHSSIVFSNETLSPGTVATYACERGFELLGPSRRVCDKTGQWMPEGIPFC 76
C P + + + ++ C G+ L G + R C G+W + C
Sbjct: 2 CPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQ-TAIC 57
|
| >d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 59 | Back information, alignment and structure |
|---|
| >d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 59 | Back information, alignment and structure |
|---|
| >d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 60 | Back information, alignment and structure |
|---|
| >d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 58 | Back information, alignment and structure |
|---|
| >d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 58 | Back information, alignment and structure |
|---|
| >d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Length = 67 | Back information, alignment and structure |
|---|
| >d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} Length = 62 | Back information, alignment and structure |
|---|
| >d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Length = 62 | Back information, alignment and structure |
|---|
| >d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 | Back information, alignment and structure |
|---|
| >d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} Length = 64 | Back information, alignment and structure |
|---|
| >d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Length = 75 | Back information, alignment and structure |
|---|
| >d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 87 | |||
| d2ok5a3 | 61 | Complement factor B {Human (Homo sapiens) [TaxId: | 99.84 | |
| d1quba4 | 60 | beta2-glycoprotein I {Human (Homo sapiens) [TaxId: | 99.82 | |
| d1g40a3 | 58 | Complement control protein {Vaccinia virus [TaxId: | 99.82 | |
| d1quba2 | 58 | beta2-glycoprotein I {Human (Homo sapiens) [TaxId: | 99.81 | |
| d2o39c2 | 64 | CD46 (membrane cofactor protein, MCP) {Human (Homo | 99.81 | |
| d1quba3 | 63 | beta2-glycoprotein I {Human (Homo sapiens) [TaxId: | 99.81 | |
| d1ly2a1 | 67 | Complement receptor 2, cr2 {Human (Homo sapiens) [ | 99.81 | |
| d2ok5a2 | 62 | Complement factor B {Human (Homo sapiens) [TaxId: | 99.8 | |
| d1h03p2 | 63 | Complement decay-accelerating factor (Daf, CD55) { | 99.8 | |
| d1gpza2 | 68 | Complement C1R protease domains {Human (Homo sapie | 99.8 | |
| d1hcca_ | 59 | Factor H, 15th and 16th modules {Human (Homo sapie | 99.8 | |
| d1quba1 | 62 | beta2-glycoprotein I {Human (Homo sapiens) [TaxId: | 99.79 | |
| d1ly2a2 | 63 | Complement receptor 2, cr2 {Human (Homo sapiens) [ | 99.78 | |
| d1ok3a2 | 64 | Complement decay-accelerating factor (Daf, CD55) { | 99.77 | |
| d1hfia_ | 62 | Factor H, 15th and 16th modules {Human (Homo sapie | 99.77 | |
| d1h03p1 | 62 | Complement decay-accelerating factor (Daf, CD55) { | 99.76 | |
| d1g40a2 | 62 | Complement control protein {Vaccinia virus [TaxId: | 99.76 | |
| d1g40a4 | 59 | Complement control protein {Vaccinia virus [TaxId: | 99.75 | |
| d1gkga2 | 70 | Complement receptor 1, cr1 {Human (Homo sapiens) [ | 99.75 | |
| d1ok3a1 | 64 | Complement decay-accelerating factor (Daf, CD55) { | 99.75 | |
| d1ppqa_ | 68 | Complement receptor 1, cr1 {Human (Homo sapiens) [ | 99.75 | |
| d1md8a2 | 76 | Complement C1R protease domains {Human (Homo sapie | 99.72 | |
| d1gkna1 | 64 | Complement receptor 1, cr1 {Human (Homo sapiens) [ | 99.71 | |
| d1elva2 | 68 | Complement C1S protease domain {Human (Homo sapien | 99.69 | |
| d2o39c1 | 62 | CD46 (membrane cofactor protein, MCP) {Human (Homo | 99.69 | |
| d1q3xa2 | 75 | Mannan-binding lectin serine protease 2 (MASP-2) d | 99.68 | |
| d1zjka2 | 53 | Complement C1R protease domains {Human (Homo sapie | 99.67 | |
| d1srza_ | 68 | GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: | 99.64 | |
| d2z3qb1 | 78 | Interleukin-15 receptor subunit alpha {Human (Homo | 99.59 | |
| d2ok5a4 | 68 | Complement factor B {Human (Homo sapiens) [TaxId: | 98.35 | |
| d2b5id2 | 63 | Interleukin-2 receptor alpha chain {Human (Homo sa | 98.2 | |
| d1g40a1 | 64 | Complement control protein {Vaccinia virus [TaxId: | 97.92 | |
| d2b5id1 | 64 | Interleukin-2 receptor alpha chain {Human (Homo sa | 95.05 | |
| d2joda1 | 106 | Pituitary adenylate cyclase-activating polypeptide | 92.23 |
| >d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Complement control module/SCR domain superfamily: Complement control module/SCR domain family: Complement control module/SCR domain domain: Complement factor B species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.84 E-value=4.5e-21 Score=95.55 Aligned_cols=60 Identities=18% Similarity=0.436 Sum_probs=55.7
Q ss_pred cCCCCCCCCCeEEEecCCCcCCCCEEEEEcCCCCEEcCCCceeeCCCCccCCCCCCeEeec
Q psy6641 19 ECRFPGAPAHSSIVFSNETLSPGTVATYACERGFELLGPSRRVCDKTGQWMPEGIPFCVRW 79 (87)
Q Consensus 19 ~C~~p~~~~~g~~~~~~~~~~~g~~~~~~C~~gy~l~G~~~~~C~~~g~Ws~~~~p~C~~~ 79 (87)
.|+.|+.+.||.+...+..|.+|++|+|.|++||.|.|+..++|+.+|+|+.+ .|.|+..
T Consensus 1 ~Cp~p~~~~nG~~~~~~~~~~~g~~v~y~C~~Gy~l~G~~~~~C~~~g~Ws~~-~P~C~d~ 60 (61)
T d2ok5a3 1 HCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQ-TAICDNG 60 (61)
T ss_dssp EECCCSCCTTEEEESCCSSEETTCEEEEEECTTCEEESCSEEEBCTTSCBSSC-CCEEECS
T ss_pred CccCCCCCCCcEEecCCCcccCCCEEEEECCCCCEEeCCCeeEECCCCeECCC-CCeecCC
Confidence 48999999999998877789999999999999999999999999999999998 9999863
|
| >d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g40a3 g.18.1.1 (A:127-184) Complement control protein {Vaccinia virus [TaxId: 10245]} | Back information, alignment and structure |
|---|
| >d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o39c2 g.18.1.1 (C:63-126) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ly2a1 g.18.1.1 (A:0-66) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h03p2 g.18.1.1 (P:67-129) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gpza2 g.18.1.1 (A:290-357) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hcca_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1quba1 g.18.1.1 (A:1-62) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ok3a2 g.18.1.1 (A:65-128) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h03p1 g.18.1.1 (P:5-66) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g40a2 g.18.1.1 (A:65-126) Complement control protein {Vaccinia virus [TaxId: 10245]} | Back information, alignment and structure |
|---|
| >d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} | Back information, alignment and structure |
|---|
| >d1gkga2 g.18.1.1 (A:1023-1092) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ppqa_ g.18.1.1 (A:) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1md8a2 g.18.1.1 (A:358-433) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkna1 g.18.1.1 (A:897-960) Complement receptor 1, cr1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1srza_ g.18.1.1 (A:) GABA-B receptor 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2z3qb1 g.18.1.1 (B:1-78) Interleukin-15 receptor subunit alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5id2 g.18.1.1 (D:103-165) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g40a1 g.18.1.1 (A:1-64) Complement control protein {Vaccinia virus [TaxId: 10245]} | Back information, alignment and structure |
|---|
| >d2b5id1 g.18.1.1 (D:1-64) Interleukin-2 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2joda1 g.76.1.1 (A:17-122) Pituitary adenylate cyclase-activating polypeptide type I receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|