Diaphorina citri psyllid: psy6642

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--

MLAHSDIRTPDFSKYRRDRNPDKGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDPQADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGDEGILIRMLAHSDIRTPDFSKYRRDRNPDKGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHR

ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccEEEEccccccccEEEEEEccEEEEEEEccHHHHHHHHcccccccccccccccccccccEEEEEcccccccccccccccccccEEcccccccccccccccccccccccccccEEEccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccEEEEccccccccEEEEEEccEEEEEEcc

*LAHSDIRTPDFS******************AFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQK**********************VKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGDEGILIRMLAHSDIRTPDF*******************AFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHR

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytochrome b-c1 complex subunit Rieske, mitochondrial	The transit peptide of the Rieske protein seems to form part of the bc1 complex and is considered to be the subunit 11/IX of that complex.	confident	P13272
Cytochrome b-c1 complex subunit Rieske, mitochondrial	Component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c.	confident	P08067
Putative cytochrome b-c1 complex subunit Rieske-like protein 1		confident	P0C7P4

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005750 [CC]	mitochondrial respiratory chain complex III	confident	GO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0045275, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0005488 [MF]	binding	confident	GO:0003674
GO:0046872 [MF]	metal ion binding	probable	GO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0032403 [MF]	protein complex binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0006122 [BP]	mitochondrial electron transport, ubiquinol to cytochrome c	probable	GO:0044710, GO:0015980, GO:0006793, GO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042775, GO:0042773, GO:0055114, GO:0006119
GO:0044281 [BP]	small molecule metabolic process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0008121 [MF]	ubiquinol-cytochrome-c reductase activity	probable	GO:0022891, GO:0022890, GO:0022892, GO:0005215, GO:0008324, GO:0022857, GO:0015075, GO:0003824, GO:0015077, GO:0003674, GO:0016679, GO:0015078, GO:0016681, GO:0016491
GO:0000003 [BP]	reproduction	probable	GO:0008150
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0043581 [BP]	mycelium development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0009725 [BP]	response to hormone stimulus	probable	GO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033
GO:0046677 [BP]	response to antibiotic	probable	GO:0008150, GO:0042221, GO:0050896, GO:0009636
GO:0042493 [BP]	response to drug	probable	GO:0042221, GO:0050896, GO:0008150
GO:0009060 [BP]	aerobic respiration	probable	GO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0051537 [MF]	2 iron, 2 sulfur cluster binding	probable	GO:0051536, GO:0003674, GO:0051540, GO:0005488
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005875 [CC]	microtubule associated complex	probable	GO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.10.-.-	Acting on diphenols and related substances as donors.	probable
1.10.2.-	With a cytochrome as acceptor.	probable
1.10.2.2	Ubiquinol--cytochrome-c reductase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1RIE, chain A
Confidence level:very confident
Coverage over the Query: 68-192
View the alignment between query and template
View the model in PyMOL

Template: 1PP9, chain E
Confidence level:very confident
Coverage over the Query: 3-192
View the alignment between query and template
View the model in PyMOL

Template: 1PP9, chain E
Confidence level:very confident
Coverage over the Query: 196-292
View the alignment between query and template
View the model in PyMOL