Psyllid ID: psy6642


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MLAHSDIRTPDFSKYRRDRNPDKGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDPQADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGDEGILIRMLAHSDIRTPDFSKYRRDRNPDKGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHR
ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccEEEEccccccccEEEEEEccEEEEEEEccHHHHHHHHcccccccccccccccccccccEEEEEcccccccccccccccccccEEcccccccccccccccccccccccccccEEEccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccEEEEccccccccEEEEEEccEEEEEEcc
ccccccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEHHHcccccEEEEEEccEEEEEEEccHHHHHHHHcccHHHccccccHHHccccccEEEEEccccccccccEEcccccEEEEEccccEEEEccccEEEcccccccccccEEEccccEEEEEcccccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEHHHcccccEEEEEEccEEEEEEEc
mlahsdirtpdfskyrrdrnpdkgqeETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDlnlipegqsvtfkwrgkplfirhRTQKEidteqntnisqlrdpqadsdrvkdpswLVIIGICThlgcvpianagdwggyycpchgshydasgrirkgpaptnmevppyqfgdegILIRMLahsdirtpdfskyrrdrnpdkgqeETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDlnlipegqsvtfkwrgkplfirhr
mlahsdirtpdfskyrrdrnpdkgqeetqRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLnlipegqsvtfkwrgkpLFIRHRtqkeidteqntnisqlrdpqadsdrVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGDEGILIRMLAHsdirtpdfskyrrdrnpdkgqeetqRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDlnlipegqsvtfkwrgkplfirhr
MLAHSDIRTPDFSKYRRDRNPDKGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDPQADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGDEGILIRMLAHSDIRTPDFSKYRRDRNPDKGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHR
*******************************AFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHR****************************PSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRI**********VPPYQFGDEGILIRMLAHSDI************************AFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFI***
*LAHSDIRTPDFS********************TYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQK**********************VKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGDEGILIRMLAHSDIRTPDF*********************TYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHR
MLAHSDIRTPDFSKYRR***********QRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQ**********VKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGDEGILIRMLAHSDIRTPDFSKYR************QRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHR
****SDIRTPDFSKYRRDRNPDKGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDPQADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGDEGILIRMLAHSDIRTPDFSKYRRDRNPDKGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLAHSDIRTPDFSKYRRDRNPDKGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDPQADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGDEGILIRMLAHSDIRTPDFSKYRRDRNPDKGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query292 2.2.26 [Sep-21-2011]
Q69BJ7274 Cytochrome b-c1 complex s N/A N/A 0.650 0.693 0.628 5e-73
Q69BJ8274 Cytochrome b-c1 complex s N/A N/A 0.650 0.693 0.625 6e-73
Q69BK3274 Cytochrome b-c1 complex s N/A N/A 0.650 0.693 0.623 2e-72
Q69BJ9274 Cytochrome b-c1 complex s N/A N/A 0.650 0.693 0.618 3e-72
Q69BK1274 Cytochrome b-c1 complex s N/A N/A 0.650 0.693 0.620 7e-72
P47985274 Cytochrome b-c1 complex s yes N/A 0.650 0.693 0.613 2e-71
Q69BK4274 Cytochrome b-c1 complex s N/A N/A 0.650 0.693 0.613 2e-71
Q9CR68274 Cytochrome b-c1 complex s yes N/A 0.654 0.697 0.605 3e-71
Q69BK5274 Cytochrome b-c1 complex s yes N/A 0.650 0.693 0.608 4e-71
Q69BK6274 Cytochrome b-c1 complex s N/A N/A 0.650 0.693 0.608 4e-71
>sp|Q69BJ7|UCRI_SAISC Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Saimiri sciureus GN=UQCRFS1 PE=3 SV=1 Back     alignment and function desciption
 Score =  274 bits (701), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 122/194 (62%), Positives = 152/194 (78%), Gaps = 4/194 (2%)

Query: 3   AHSDIRTPDFSKYRRDRNPDKGQEETQ----RKAFTYMIAGGSSVVGMVCAKSVVNQFIS 58
           +H+DI+ PDFS YRR    DK +   +    RK F+YM+   ++V     AKS+V QFIS
Sbjct: 79  SHTDIKVPDFSDYRRSEVLDKTKSSRESSDARKVFSYMVTATTAVGVTYAAKSIVTQFIS 138

Query: 59  SMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDP 118
           SMSASADVLAM+ IE+ L+ IPEG+++ FKWRGKPLF+RHRTQKEI+ E    +SQLRDP
Sbjct: 139 SMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDP 198

Query: 119 QADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNM 178
           Q D DRVK P W+++IG+CTHLGCVPIANAGD+GGYYCPCHGSHYDASGRIRKGPAP N+
Sbjct: 199 QHDLDRVKKPEWMILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNL 258

Query: 179 EVPPYQFGDEGILI 192
           EVP Y+F  + +++
Sbjct: 259 EVPTYEFLSDDMVV 272




The transit peptide of the Rieske protein seems to form part of the bc1 complex and is considered to be the subunit 11/IX of that complex.
Saimiri sciureus (taxid: 9521)
EC: 1EC: .EC: 1EC: 0EC: .EC: 2EC: .EC: 2
>sp|Q69BJ8|UCRI_LAGLA Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Lagothrix lagotricha GN=UQCRFS1 PE=3 SV=1 Back     alignment and function description
>sp|Q69BK3|UCRI_PONPY Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Pongo pygmaeus GN=UQCRFS1 PE=3 SV=1 Back     alignment and function description
>sp|Q69BJ9|UCRI_AOTAZ Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Aotus azarae GN=UQCRFS1 PE=3 SV=1 Back     alignment and function description
>sp|Q69BK1|UCRI_CHLAE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Chlorocebus aethiops GN=UQCRFS1 PE=3 SV=1 Back     alignment and function description
>sp|P47985|UCRI_HUMAN Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Homo sapiens GN=UQCRFS1 PE=1 SV=2 Back     alignment and function description
>sp|Q69BK4|UCRI_GORGO Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Gorilla gorilla gorilla GN=UQCRFS1 PE=3 SV=1 Back     alignment and function description
>sp|Q9CR68|UCRI_MOUSE Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Mus musculus GN=Uqcrfs1 PE=1 SV=1 Back     alignment and function description
>sp|Q69BK5|UCRI_PANTR Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Pan troglodytes GN=UQCRFS1 PE=3 SV=1 Back     alignment and function description
>sp|Q69BK6|UCRI_PANPA Cytochrome b-c1 complex subunit Rieske, mitochondrial OS=Pan paniscus GN=UQCRFS1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
348519190240 PREDICTED: cytochrome b-c1 complex subun 0.654 0.795 0.635 5e-75
288814596272 ubiquinol-cytochrome c reductase [Locust 0.650 0.698 0.673 9e-75
209734266273 Cytochrome b-c1 complex subunit Rieske, 0.654 0.699 0.646 1e-74
283046728268 ubiquinol-cytochrome c reductase, Rieske 0.650 0.708 0.680 1e-74
37747939273 Ubiquinol-cytochrome c reductase, Rieske 0.654 0.699 0.641 2e-74
157073897273 cytochrome b-c1 complex subunit Rieske, 0.654 0.699 0.641 2e-74
158299624265 AGAP008955-PA [Anopheles gambiae str. PE 0.650 0.716 0.663 4e-74
432862546235 PREDICTED: cytochrome b-c1 complex subun 0.654 0.812 0.635 4e-74
289742957258 ubiquinol cytochrome c reductase subunit 0.654 0.740 0.664 5e-74
289742955248 ubiquinol cytochrome c reductase subunit 0.654 0.770 0.664 7e-74
>gi|348519190|ref|XP_003447114.1| PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial-like [Oreochromis niloticus] Back     alignment and taxonomy information
 Score =  287 bits (734), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 124/195 (63%), Positives = 164/195 (84%), Gaps = 4/195 (2%)

Query: 2   LAHSDIRTPDFSKYRRDR--NPDKGQEETQ--RKAFTYMIAGGSSVVGMVCAKSVVNQFI 57
           LAH+DI+ PDFS YRR    +P+K  +E+   R+AF+Y++ G ++VVG+  AK+VV QFI
Sbjct: 44  LAHTDIKIPDFSDYRRPEVMDPNKSSQESSEARRAFSYLVTGATTVVGVYAAKTVVTQFI 103

Query: 58  SSMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRD 117
           SSMSASADVLA++ IE+ L+ IPEG+++TFKWRGKPLF+RHRT+KEI TEQ  N+++LRD
Sbjct: 104 SSMSASADVLALSKIEIKLSDIPEGKNMTFKWRGKPLFVRHRTEKEIATEQAVNLAELRD 163

Query: 118 PQADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTN 177
           P+ D DRV +P W++++G+CTHLGCVPIANAG++GGYYCPCHGSHYDASGRIRKGPAP N
Sbjct: 164 PEHDKDRVTNPKWVIVLGVCTHLGCVPIANAGEYGGYYCPCHGSHYDASGRIRKGPAPLN 223

Query: 178 MEVPPYQFGDEGILI 192
           +EVP Y+F D+  ++
Sbjct: 224 LEVPYYEFQDDETVV 238




Source: Oreochromis niloticus

Species: Oreochromis niloticus

Genus: Oreochromis

Family: Cichlidae

Order: Perciformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|288814596|gb|ADC54384.1| ubiquinol-cytochrome c reductase [Locusta migratoria manilensis] Back     alignment and taxonomy information
>gi|209734266|gb|ACI68002.1| Cytochrome b-c1 complex subunit Rieske, mitochondrial precursor [Salmo salar] Back     alignment and taxonomy information
>gi|283046728|ref|NP_001164310.1| ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 [Tribolium castaneum] gi|270004785|gb|EFA01233.1| hypothetical protein TcasGA2_TC000043 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|37747939|gb|AAH59475.1| Ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 [Danio rerio] Back     alignment and taxonomy information
>gi|157073897|ref|NP_001096664.1| cytochrome b-c1 complex subunit Rieske, mitochondrial [Danio rerio] gi|292616189|ref|XP_002662916.1| PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial-like isoform 1 [Danio rerio] gi|326669539|ref|XP_003199036.1| PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial-like isoform 2 [Danio rerio] gi|156230934|gb|AAI52278.1| Ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1 [Danio rerio] Back     alignment and taxonomy information
>gi|158299624|ref|XP_319708.4| AGAP008955-PA [Anopheles gambiae str. PEST] gi|157013606|gb|EAA14787.4| AGAP008955-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|432862546|ref|XP_004069909.1| PREDICTED: cytochrome b-c1 complex subunit Rieske, mitochondrial-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|289742957|gb|ADD20226.1| ubiquinol cytochrome c reductase subunit RIP1 [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|289742955|gb|ADD20225.1| ubiquinol cytochrome c reductase subunit RIP1 [Glossina morsitans morsitans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
ZFIN|ZDB-GENE-040426-2060273 uqcrfs1 "ubiquinol-cytochrome 0.650 0.695 0.644 1.4e-69
UNIPROTKB|E2R1A6274 UQCRFS1 "Ubiquinol-cytochrome 0.650 0.693 0.635 2.2e-66
MGI|MGI:1913944274 Uqcrfs1 "ubiquinol-cytochrome 0.650 0.693 0.618 1.2e-65
UNIPROTKB|G3MXD1271 UQCRFS1 "Ubiquinol-cytochrome 0.650 0.701 0.623 2.5e-65
UNIPROTKB|P13272274 UQCRFS1 "Cytochrome b-c1 compl 0.650 0.693 0.623 2.5e-65
UNIPROTKB|F1RNZ1274 UQCRFS1 "Uncharacterized prote 0.650 0.693 0.628 2.5e-65
UNIPROTKB|P47985274 UQCRFS1 "Cytochrome b-c1 compl 0.650 0.693 0.613 6.7e-65
RGD|628838274 Uqcrfs1 "ubiquinol-cytochrome 0.650 0.693 0.613 1.8e-64
UNIPROTKB|Q5ZLR5272 UQCRFS1 "Cytochrome b-c1 compl 0.647 0.694 0.608 4.7e-64
UNIPROTKB|P0C7P4283 UQCRFS1P1 "Putative cytochrome 0.650 0.671 0.618 9.7e-64
ZFIN|ZDB-GENE-040426-2060 uqcrfs1 "ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 705 (253.2 bits), Expect = 1.4e-69, P = 1.4e-69
 Identities = 125/194 (64%), Positives = 162/194 (83%)

Query:     3 AHSDIRTPDFSKYRRDR--NPDKGQEET--QRKAFTYMIAGGSSVVGMVCAKSVVNQFIS 58
             AH+DI+ PDFS YRR    NP+K  +E+   R+AF+Y++ G + VVG+  AK+VV QF+S
Sbjct:    78 AHTDIKIPDFSDYRRPEVLNPNKQSQESGDARRAFSYLMTGSTLVVGVYTAKTVVTQFVS 137

Query:    59 SMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDP 118
             SMSASADVLA++ IE+ L  IPEG+++TFKWRGKPLF+RHRT+KEI+TE   N+++LRDP
Sbjct:   138 SMSASADVLALSKIEIKLADIPEGKNMTFKWRGKPLFVRHRTEKEIETEAGVNLAELRDP 197

Query:   119 QADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNM 178
             Q D DRV +PSW+++IG+CTHLGCVPIANAG++GGYYCPCHGSHYDASGRIRKGPAP N+
Sbjct:   198 QHDKDRVVNPSWVIVIGVCTHLGCVPIANAGEFGGYYCPCHGSHYDASGRIRKGPAPLNL 257

Query:   179 EVPPYQFGDEGILI 192
             EVP Y+F D+  ++
Sbjct:   258 EVPYYEFPDDDTVV 271


GO:0016679 "oxidoreductase activity, acting on diphenols and related substances as donors" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0008121 "ubiquinol-cytochrome-c reductase activity" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0051537 "2 iron, 2 sulfur cluster binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
GO:0051536 "iron-sulfur cluster binding" evidence=IEA
GO:0070469 "respiratory chain" evidence=IEA
GO:0022900 "electron transport chain" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
GO:0006810 "transport" evidence=IEA
UNIPROTKB|E2R1A6 UQCRFS1 "Ubiquinol-cytochrome c reductase iron-sulfur subunit" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1913944 Uqcrfs1 "ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXD1 UQCRFS1 "Ubiquinol-cytochrome c reductase iron-sulfur subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P13272 UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RNZ1 UQCRFS1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P47985 UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|628838 Uqcrfs1 "ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLR5 UQCRFS1 "Cytochrome b-c1 complex subunit Rieske, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P0C7P4 UQCRFS1P1 "Putative cytochrome b-c1 complex subunit Rieske-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51130UCRI_BRAJA1, ., 1, 0, ., 2, ., 20.58640.44520.7386yesN/A
P13272UCRI_BOVIN1, ., 1, 0, ., 2, ., 20.61340.65060.6934yesN/A
P08067UCRI_YEAST1, ., 1, 0, ., 2, ., 20.52840.63690.8651yesN/A
Q9CR68UCRI_MOUSE1, ., 1, 0, ., 2, ., 20.60510.65410.6970yesN/A
Q9ZDQ5UCRI_RICPR1, ., 1, 0, ., 2, ., 20.51200.55130.9096yesN/A
Q4UKR6UCRI_RICFE1, ., 1, 0, ., 2, ., 20.50600.55130.9096yesN/A
Q92IR2UCRI_RICCN1, ., 1, 0, ., 2, ., 20.50600.55130.9096yesN/A
Q09154UCRI_SCHPO1, ., 1, 0, ., 2, ., 20.54090.60610.7763yesN/A
P0C7P4UCRIL_HUMANNo assigned EC number0.60820.65060.6713yesN/A
P47985UCRI_HUMAN1, ., 1, 0, ., 2, ., 20.61340.65060.6934yesN/A
Q1RIA5UCRI_RICBR1, ., 1, 0, ., 2, ., 20.52140.54100.8494yesN/A
P20788UCRI_RAT1, ., 1, 0, ., 2, ., 20.60300.65060.6934yesN/A
Q69BK5UCRI_PANTR1, ., 1, 0, ., 2, ., 20.60820.65060.6934yesN/A
Q5ZLR5UCRI_CHICK1, ., 1, 0, ., 2, ., 20.60300.64720.6948yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.10.2.20.824
3rd Layer1.10.20.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
cd03470126 cd03470, Rieske_cytochrome_bc1, Iron-sulfur protei 5e-76
TIGR01416174 TIGR01416, Rieske_proteo, ubiquinol-cytochrome c r 2e-67
COG0723177 COG0723, QcrA, Rieske Fe-S protein [Energy product 2e-41
pfam0292163 pfam02921, UCR_TM, Ubiquinol cytochrome reductase 2e-21
pfam0292163 pfam02921, UCR_TM, Ubiquinol cytochrome reductase 2e-21
pfam0035599 pfam00355, Rieske, Rieske [2Fe-2S] domain 1e-16
TIGR01416 174 TIGR01416, Rieske_proteo, ubiquinol-cytochrome c r 5e-16
PRK13474178 PRK13474, PRK13474, cytochrome b6-f complex iron-s 2e-14
cd03471126 cd03471, Rieske_cytochrome_b6f, Iron-sulfur protei 3e-14
cd0346798 cd03467, Rieske, Rieske domain; a [2Fe-2S] cluster 4e-12
cd03470126 cd03470, Rieske_cytochrome_bc1, Iron-sulfur protei 8e-11
COG0723177 COG0723, QcrA, Rieske Fe-S protein [Energy product 3e-07
cd0347791 cd03477, Rieske_YhfW_C, YhfW family, C-terminal Ri 9e-07
cd03476126 cd03476, Rieske_ArOX_small, Small subunit of Arsen 5e-04
TIGR02694129 TIGR02694, arsenite_ox_S, arsenite oxidase, small 0.002
>gnl|CDD|239552 cd03470, Rieske_cytochrome_bc1, Iron-sulfur protein (ISP) component of the bc(1) complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
 Score =  227 bits (581), Expect = 5e-76
 Identities = 74/124 (59%), Positives = 93/124 (75%), Gaps = 2/124 (1%)

Query: 71  TIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDP--QADSDRVKDP 128
            +EVDL+ I EGQ +T +WRGKP+FIR RT +EI   +  ++S L DP   A+  R   P
Sbjct: 1   PVEVDLSKIEEGQLITVEWRGKPVFIRRRTPEEIAEAKAVDLSLLDDPDPAANRVRSGKP 60

Query: 129 SWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGDE 188
            WLV+IGICTHLGCVP   AGD+GG++CPCHGSHYDASGRIRKGPAP N+EVPPY+F  +
Sbjct: 61  EWLVVIGICTHLGCVPTYRAGDYGGFFCPCHGSHYDASGRIRKGPAPLNLEVPPYKFLSD 120

Query: 189 GILI 192
             ++
Sbjct: 121 TTIV 124


The bc(1) complex is a multisubunit enzyme found in many different organisms including uni- and multi-cellular eukaryotes, plants (in their mitochondria) and bacteria. The cytochrome bc(1) and b6f complexes are central components of the respiratory and photosynthetic electron transport chains, respectively, which carry out similar core electron and proton transfer steps. The bc(1) and b6f complexes share a common core structure of three catalytic subunits: cyt b, the Rieske ISP, and either a cyt c1 in the bc(1) complex or cyt f in the b6f complex, which are arranged in an integral membrane-bound dimeric complex. While the core of the b6f complex is similar to that of the bc(1) complex, the domain arrangement outside the core and the complement of prosthetic groups are strikingly different. Length = 126

>gnl|CDD|233404 TIGR01416, Rieske_proteo, ubiquinol-cytochrome c reductase, iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|223795 COG0723, QcrA, Rieske Fe-S protein [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|217287 pfam02921, UCR_TM, Ubiquinol cytochrome reductase transmembrane region Back     alignment and domain information
>gnl|CDD|217287 pfam02921, UCR_TM, Ubiquinol cytochrome reductase transmembrane region Back     alignment and domain information
>gnl|CDD|215875 pfam00355, Rieske, Rieske [2Fe-2S] domain Back     alignment and domain information
>gnl|CDD|233404 TIGR01416, Rieske_proteo, ubiquinol-cytochrome c reductase, iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|237392 PRK13474, PRK13474, cytochrome b6-f complex iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|239553 cd03471, Rieske_cytochrome_b6f, Iron-sulfur protein (ISP) component of the b6f complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>gnl|CDD|239550 cd03467, Rieske, Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes Back     alignment and domain information
>gnl|CDD|239552 cd03470, Rieske_cytochrome_bc1, Iron-sulfur protein (ISP) component of the bc(1) complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>gnl|CDD|223795 COG0723, QcrA, Rieske Fe-S protein [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|239559 cd03477, Rieske_YhfW_C, YhfW family, C-terminal Rieske domain; YhfW is a protein of unknown function with an N-terminal DadA-like (glycine/D-amino acid dehydrogenase) domain and a C-terminal Rieske domain Back     alignment and domain information
>gnl|CDD|239558 cd03476, Rieske_ArOX_small, Small subunit of Arsenite oxidase (ArOX) family, Rieske domain; ArOX is a molybdenum/iron protein involved in the detoxification of arsenic, oxidizing it to arsenate Back     alignment and domain information
>gnl|CDD|131741 TIGR02694, arsenite_ox_S, arsenite oxidase, small subunit Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 292
KOG1671|consensus210 100.0
TIGR01416174 Rieske_proteo ubiquinol-cytochrome c reductase, ir 100.0
cd03470126 Rieske_cytochrome_bc1 Iron-sulfur protein (ISP) co 99.96
COG0723177 QcrA Rieske Fe-S protein [Energy production and co 99.95
PRK13474178 cytochrome b6-f complex iron-sulfur subunit; Provi 99.95
KOG1671|consensus210 99.87
TIGR03171321 soxL2 Rieske iron-sulfur protein SoxL2. This iron- 99.86
TIGR02377101 MocE_fam_FeS Rieske [2Fe-2S] domain protein, MocE 99.85
cd0352898 Rieske_RO_ferredoxin Rieske non-heme iron oxygenas 99.85
cd0347895 Rieske_AIFL_N AIFL (apoptosis-inducing factor like 99.84
cd03476126 Rieske_ArOX_small Small subunit of Arsenite oxidas 99.84
PRK09965106 3-phenylpropionate dioxygenase ferredoxin subunit; 99.82
cd0353098 Rieske_NirD_small_Bacillus Small subunit of nitrit 99.82
PF0035597 Rieske: Rieske [2Fe-2S] domain; InterPro: IPR01794 99.82
cd03469118 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase ( 99.81
cd0347791 Rieske_YhfW_C YhfW family, C-terminal Rieske domai 99.81
cd04337129 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) 99.81
cd03471126 Rieske_cytochrome_b6f Iron-sulfur protein (ISP) co 99.81
cd03474108 Rieske_T4moC Toluene-4-monooxygenase effector prot 99.81
cd03479144 Rieske_RO_Alpha_PhDO_like Rieske non-heme iron oxy 99.8
cd03531115 Rieske_RO_Alpha_KSH The alignment model represents 99.8
TIGR02694129 arsenite_ox_S arsenite oxidase, small subunit. Thi 99.77
cd04338134 Rieske_RO_Alpha_Tic55 Tic55 is a 55kDa LLS1-relate 99.77
cd03532116 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxy 99.77
COG2146106 {NirD} Ferredoxin subunits of nitrite reductase an 99.75
cd03548136 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxy 99.75
cd0346798 Rieske Rieske domain; a [2Fe-2S] cluster binding d 99.74
cd03529103 Rieske_NirD Assimilatory nitrite reductase (NirD) 99.74
TIGR02378105 nirD_assim_sml nitrite reductase [NAD(P)H], small 99.74
PRK09511108 nirD nitrite reductase small subunit; Provisional 99.73
cd03480138 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase 99.72
cd03536123 Rieske_RO_Alpha_DTDO This alignment model represen 99.71
cd03475171 Rieske_SoxF_SoxL SoxF and SoxL family, Rieske doma 99.69
cd03472128 Rieske_RO_Alpha_BPDO_like Rieske non-heme iron oxy 99.69
cd03537123 Rieske_RO_Alpha_PrnD This alignment model represen 99.66
PF13806104 Rieske_2: Rieske-like [2Fe-2S] domain; PDB: 2JO6_A 99.66
cd03473107 Rieske_CMP_Neu5Ac_hydrolase_N Cytidine monophospha 99.66
PLN02281 536 chlorophyllide a oxygenase 99.65
cd03545150 Rieske_RO_Alpha_OHBDO_like Rieske non-heme iron ox 99.65
cd03539129 Rieske_RO_Alpha_S5H This alignment model represent 99.63
PLN00095 394 chlorophyllide a oxygenase; Provisional 99.62
cd03535123 Rieske_RO_Alpha_NDO Rieske non-heme iron oxygenase 99.62
cd03541118 Rieske_RO_Alpha_CMO Rieske non-heme iron oxygenase 99.62
cd03538146 Rieske_RO_Alpha_AntDO Rieske non-heme iron oxygena 99.6
cd03542123 Rieske_RO_Alpha_HBDO Rieske non-heme iron oxygenas 99.6
TIGR01416 174 Rieske_proteo ubiquinol-cytochrome c reductase, ir 99.53
PLN02518 539 pheophorbide a oxygenase 99.52
PF0292164 UCR_TM: Ubiquinol cytochrome reductase transmembra 99.45
TIGR03228 438 anthran_1_2_A anthranilate 1,2-dioxygenase, large 99.42
TIGR03229 433 benzo_1_2_benA benzoate 1,2-dioxygenase, large sub 99.41
COG4638 367 HcaE Phenylpropionate dioxygenase and related ring 99.34
PF0292164 UCR_TM: Ubiquinol cytochrome reductase transmembra 99.31
PF1039941 UCR_Fe-S_N: Ubiquitinol-cytochrome C reductase Fe- 98.93
COG0723177 QcrA Rieske Fe-S protein [Energy production and co 98.59
PF1039941 UCR_Fe-S_N: Ubiquitinol-cytochrome C reductase Fe- 98.11
PRK13474178 cytochrome b6-f complex iron-sulfur subunit; Provi 98.0
TIGR03171 321 soxL2 Rieske iron-sulfur protein SoxL2. This iron- 95.62
KOG1336|consensus 478 95.4
PF0880239 CytB6-F_Fe-S: Cytochrome B6-F complex Fe-S subunit 91.15
PF0880239 CytB6-F_Fe-S: Cytochrome B6-F complex Fe-S subunit 89.5
PF1051826 TAT_signal: TAT (twin-arginine translocation) path 85.41
TIGR0281166 formate_TAT formate dehydrogenase region TAT targe 85.36
>KOG1671|consensus Back     alignment and domain information
Probab=100.00  E-value=1.2e-43  Score=307.23  Aligned_cols=188  Identities=63%  Similarity=1.116  Sum_probs=176.1

Q ss_pred             CCCCCCCCCccccccCCCCC-CCCCCcCchhhHHHHHHhHHHHHHHHHHHHHHHhhcCCCcchhhhccccceeecCCCCC
Q psy6642           3 AHSDIRTPDFSKYRRDRNPD-KGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNLIPE   81 (292)
Q Consensus         3 ~~~~~~~pd~~~yr~~~~~~-~~~~~~~RR~fl~~atG~~~~~g~~aA~~~~~~~i~~~~p~a~~~a~~~~~v~~s~l~~   81 (292)
                      .|||+.+|||..||++.+++ ....+.+||-|.|..+|+.+++.+.+|+.++..|+.+|..++++++.+.+++++++|||
T Consensus        18 ~~t~~~~p~~~~~~~~~~~~~~~~~~~~k~~~sy~~~g~~~~~~a~~ak~~v~~fi~smsAsadvlA~akiei~l~~IPe   97 (210)
T KOG1671|consen   18 SHTDLMVPDFSDYRRESVKDHQDTGEERKGFRSYLMVGAGAAGRAYAAKNLVTTFISSMSASADVLAMAKIEIKLSDIPE   97 (210)
T ss_pred             ccccccCCCchhhhchhhhccccchhhhhceeeEEEecccceeehhhhhhhHHHHHHHhhhhhhhhhheeeeeeeecCCC
Confidence            49999999999999999888 22335555666999999999998999999999999999999999999999999999999


Q ss_pred             CCeEEEEEcCeeEEEEeCChhhhhhcccccccccCCCCcccccccCCCeEEEEecccCCCcccCCcCCCCCeEEcCCCCc
Q psy6642          82 GQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDPQADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGS  161 (292)
Q Consensus        82 g~~~~~~~~g~pv~i~~~t~~~i~~~~~v~~~~l~dp~~~~~R~~~g~~~a~~~~CtHlGc~l~~~~~~~~~~~CPcHGs  161 (292)
                      |..++++|+|+|+|+.|+++.+|+.+..|..+.++|||.++.|..+.+|+++.++||||||.+.++.+++++|+||||||
T Consensus        98 Gk~~~~kwrGkpvfirhrt~~ei~~~r~V~~s~lrDPq~d~~rvk~~ewl~~igVCThLGCVp~~~AGd~gg~~CPCHGS  177 (210)
T KOG1671|consen   98 GKTVAFKWRGKPVFIRHRTKAEIEGERNVPQSTLRDPQDDVDRVKKPEWLVVIGVCTHLGCVPIANAGDYGGYYCPCHGS  177 (210)
T ss_pred             CCCcceeccCCceEEeeccccccccccccchhhccCchhhhhhccCcceEEEEeeeccccccccccccccCceecccccc
Confidence            99999999999999999999999999999999999999888899999999999999999999999999999999999999


Q ss_pred             EEcCCCceecCCCCCCCCCCceEeecCce
Q psy6642         162 HYDASGRIRKGPAPTNMEVPPYQFGDEGI  190 (292)
Q Consensus       162 ~FD~~G~v~~gPa~~~L~~~p~~~~~d~i  190 (292)
                      +||..|++.+||||.||+++.|.|.+++.
T Consensus       178 HYdasGRIrkGPAPlnlevP~y~F~~~d~  206 (210)
T KOG1671|consen  178 HYDASGRIRKGPAPLNLEVPTYEFTSEDK  206 (210)
T ss_pred             cccccCceecCCCCCccCCCceecccCce
Confidence            99999999999999999999999998443



>TIGR01416 Rieske_proteo ubiquinol-cytochrome c reductase, iron-sulfur subunit Back     alignment and domain information
>cd03470 Rieske_cytochrome_bc1 Iron-sulfur protein (ISP) component of the bc(1) complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>COG0723 QcrA Rieske Fe-S protein [Energy production and conversion] Back     alignment and domain information
>PRK13474 cytochrome b6-f complex iron-sulfur subunit; Provisional Back     alignment and domain information
>KOG1671|consensus Back     alignment and domain information
>TIGR03171 soxL2 Rieske iron-sulfur protein SoxL2 Back     alignment and domain information
>TIGR02377 MocE_fam_FeS Rieske [2Fe-2S] domain protein, MocE subfamily Back     alignment and domain information
>cd03528 Rieske_RO_ferredoxin Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO) Back     alignment and domain information
>cd03478 Rieske_AIFL_N AIFL (apoptosis-inducing factor like) family, N-terminal Rieske domain; members of this family show similarity to human AIFL, containing an N-terminal Rieske domain and a C-terminal pyridine nucleotide-disulfide oxidoreductase domain (Pyr_redox) Back     alignment and domain information
>cd03476 Rieske_ArOX_small Small subunit of Arsenite oxidase (ArOX) family, Rieske domain; ArOX is a molybdenum/iron protein involved in the detoxification of arsenic, oxidizing it to arsenate Back     alignment and domain information
>PRK09965 3-phenylpropionate dioxygenase ferredoxin subunit; Provisional Back     alignment and domain information
>cd03530 Rieske_NirD_small_Bacillus Small subunit of nitrite reductase (NirD) family, Rieske domain; composed of proteins similar to the Bacillus subtilis small subunit of assimilatory nitrite reductase containing a Rieske domain Back     alignment and domain information
>PF00355 Rieske: Rieske [2Fe-2S] domain; InterPro: IPR017941 There are multiple types of iron-sulphur clusters which are grouped into three main categories based on their atomic content: [2Fe-2S], [3Fe-4S], [4Fe-4S] (see PDOC00176 from PROSITEDOC), and other hybrid or mixed metal types Back     alignment and domain information
>cd03469 Rieske_RO_Alpha_N Rieske non-heme iron oxygenase (RO) family, N-terminal Rieske domain of the oxygenase alpha subunit; The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms Back     alignment and domain information
>cd03477 Rieske_YhfW_C YhfW family, C-terminal Rieske domain; YhfW is a protein of unknown function with an N-terminal DadA-like (glycine/D-amino acid dehydrogenase) domain and a C-terminal Rieske domain Back     alignment and domain information
>cd04337 Rieske_RO_Alpha_Cao Cao (chlorophyll a oxygenase) is a rieske non-heme iron-sulfur protein located within the plastid-envelope inner and thylakoid membranes, that catalyzes the conversion of chlorophyllide a to chlorophyllide b Back     alignment and domain information
>cd03471 Rieske_cytochrome_b6f Iron-sulfur protein (ISP) component of the b6f complex family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03474 Rieske_T4moC Toluene-4-monooxygenase effector protein complex (T4mo), Rieske ferredoxin subunit; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03479 Rieske_RO_Alpha_PhDO_like Rieske non-heme iron oxygenase (RO) family, Phthalate 4,5-dioxygenase (PhDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of PhDO and similar proteins including 3-chlorobenzoate 3,4-dioxygenase (CBDO), phenoxybenzoate dioxygenase (POB-dioxygenase) and 3-nitrobenzoate oxygenase (MnbA) Back     alignment and domain information
>cd03531 Rieske_RO_Alpha_KSH The alignment model represents the N-terminal rieske iron-sulfur domain of KshA, the oxygenase component of 3-ketosteroid 9-alpha-hydroxylase (KSH) Back     alignment and domain information
>TIGR02694 arsenite_ox_S arsenite oxidase, small subunit Back     alignment and domain information
>cd04338 Rieske_RO_Alpha_Tic55 Tic55 is a 55kDa LLS1-related non-heme iron oxygenase associated with protein transport through the plant inner chloroplast membrane Back     alignment and domain information
>cd03532 Rieske_RO_Alpha_VanA_DdmC Rieske non-heme iron oxygenase (RO) family, Vanillate-O-demethylase oxygenase (VanA) and dicamba O-demethylase oxygenase (DdmC) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>COG2146 {NirD} Ferredoxin subunits of nitrite reductase and ring-hydroxylating dioxygenases [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>cd03548 Rieske_RO_Alpha_OMO_CARDO Rieske non-heme iron oxygenase (RO) family, 2-Oxoquinoline 8-monooxygenase (OMO) and Carbazole 1,9a-dioxygenase (CARDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03467 Rieske Rieske domain; a [2Fe-2S] cluster binding domain commonly found in Rieske non-heme iron oxygenase (RO) systems such as naphthalene and biphenyl dioxygenases, as well as in plant/cyanobacterial chloroplast b6f and mitochondrial cytochrome bc(1) complexes Back     alignment and domain information
>cd03529 Rieske_NirD Assimilatory nitrite reductase (NirD) family, Rieske domain; Assimilatory nitrate and nitrite reductases convert nitrate through nitrite to ammonium Back     alignment and domain information
>TIGR02378 nirD_assim_sml nitrite reductase [NAD(P)H], small subunit Back     alignment and domain information
>PRK09511 nirD nitrite reductase small subunit; Provisional Back     alignment and domain information
>cd03480 Rieske_RO_Alpha_PaO Rieske non-heme iron oxygenase (RO) family, Pheophorbide a oxygenase (PaO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of a small subfamily of enzymes found in plants as well as oxygenic cyanobacterial photosynthesizers including LLS1 (lethal leaf spot 1, also known as PaO) and ACD1 (accelerated cell death 1) Back     alignment and domain information
>cd03536 Rieske_RO_Alpha_DTDO This alignment model represents the N-terminal rieske domain of the oxygenase alpha subunit (DitA) of diterpenoid dioxygenase (DTDO) Back     alignment and domain information
>cd03475 Rieske_SoxF_SoxL SoxF and SoxL family, Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>cd03472 Rieske_RO_Alpha_BPDO_like Rieske non-heme iron oxygenase (RO) family, Biphenyl dioxygenase (BPDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of BPDO and similar proteins including cumene dioxygenase (CumDO), nitrobenzene dioxygenase (NBDO), alkylbenzene dioxygenase (AkbDO) and dibenzofuran 4,4a-dioxygenase (DFDO) Back     alignment and domain information
>cd03537 Rieske_RO_Alpha_PrnD This alignment model represents the N-terminal rieske domain of the oxygenase alpha subunit of aminopyrrolnitrin oxygenase (PrnD) Back     alignment and domain information
>PF13806 Rieske_2: Rieske-like [2Fe-2S] domain; PDB: 2JO6_A 3C0D_A 3D89_A 2JZA_A Back     alignment and domain information
>cd03473 Rieske_CMP_Neu5Ac_hydrolase_N Cytidine monophosphate-N-acetylneuraminic acid (CMP Neu5Ac) hydroxylase family, N-terminal Rieske domain; The Rieske domain is a [2Fe-2S] cluster binding domain involved in electron transfer Back     alignment and domain information
>PLN02281 chlorophyllide a oxygenase Back     alignment and domain information
>cd03545 Rieske_RO_Alpha_OHBDO_like Rieske non-heme iron oxygenase (RO) family, Ortho-halobenzoate-1,2-dioxygenase (OHBDO)-like subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; composed of the oxygenase alpha subunits of OHBDO, salicylate 5-hydroxylase (S5H), terephthalate 1,2-dioxygenase system (TERDOS) and similar proteins Back     alignment and domain information
>cd03539 Rieske_RO_Alpha_S5H This alignment model represents the N-terminal rieske iron-sulfur domain of the oxygenase alpha subunit (NagG) of salicylate 5-hydroxylase (S5H) Back     alignment and domain information
>PLN00095 chlorophyllide a oxygenase; Provisional Back     alignment and domain information
>cd03535 Rieske_RO_Alpha_NDO Rieske non-heme iron oxygenase (RO) family, Nathphalene 1,2-dioxygenase (NDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03541 Rieske_RO_Alpha_CMO Rieske non-heme iron oxygenase (RO) family, Choline monooxygenase (CMO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03538 Rieske_RO_Alpha_AntDO Rieske non-heme iron oxygenase (RO) family, Anthranilate 1,2-dioxygenase (AntDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>cd03542 Rieske_RO_Alpha_HBDO Rieske non-heme iron oxygenase (RO) family, 2-Halobenzoate 1,2-dioxygenase (HBDO) subfamily, N-terminal Rieske domain of the oxygenase alpha subunit; ROs comprise a large class of aromatic ring-hydroxylating dioxygenases that enable microorganisms to tolerate and utilize aromatic compounds for growth Back     alignment and domain information
>TIGR01416 Rieske_proteo ubiquinol-cytochrome c reductase, iron-sulfur subunit Back     alignment and domain information
>PLN02518 pheophorbide a oxygenase Back     alignment and domain information
>PF02921 UCR_TM: Ubiquinol cytochrome reductase transmembrane region; InterPro: IPR004192 The ubiquinol cytochrome c reductase (cytochrome bc1) complex is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis Back     alignment and domain information
>TIGR03228 anthran_1_2_A anthranilate 1,2-dioxygenase, large subunit Back     alignment and domain information
>TIGR03229 benzo_1_2_benA benzoate 1,2-dioxygenase, large subunit Back     alignment and domain information
>COG4638 HcaE Phenylpropionate dioxygenase and related ring-hydroxylating dioxygenases, large terminal subunit [Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>PF02921 UCR_TM: Ubiquinol cytochrome reductase transmembrane region; InterPro: IPR004192 The ubiquinol cytochrome c reductase (cytochrome bc1) complex is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis Back     alignment and domain information
>PF10399 UCR_Fe-S_N: Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal; InterPro: IPR019470 This entry represents the TAT-signal region found in the iron-sulphur subunit of Ubiquinol-cytochrome C reductase (also known as the cytochrome bc1 complex) Back     alignment and domain information
>COG0723 QcrA Rieske Fe-S protein [Energy production and conversion] Back     alignment and domain information
>PF10399 UCR_Fe-S_N: Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal; InterPro: IPR019470 This entry represents the TAT-signal region found in the iron-sulphur subunit of Ubiquinol-cytochrome C reductase (also known as the cytochrome bc1 complex) Back     alignment and domain information
>PRK13474 cytochrome b6-f complex iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR03171 soxL2 Rieske iron-sulfur protein SoxL2 Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PF08802 CytB6-F_Fe-S: Cytochrome B6-F complex Fe-S subunit ; InterPro: IPR014909 The cytochrome b6-f complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions Back     alignment and domain information
>PF08802 CytB6-F_Fe-S: Cytochrome B6-F complex Fe-S subunit ; InterPro: IPR014909 The cytochrome b6-f complex mediates electron transfer between photosystem II (PSII) and photosystem I (PSI), cyclic electron flow around PSI, and state transitions Back     alignment and domain information
>PF10518 TAT_signal: TAT (twin-arginine translocation) pathway signal sequence; InterPro: IPR019546 The twin-arginine translocation (Tat) pathway serves the role of transporting folded proteins across energy-transducing membranes [] Back     alignment and domain information
>TIGR02811 formate_TAT formate dehydrogenase region TAT target Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
1qcr_E196 Crystal Structure Of Bovine Mitochondrial Cytochrom 2e-71
1qcr_E196 Crystal Structure Of Bovine Mitochondrial Cytochrom 7e-25
3cwb_E196 Chicken Cytochrome Bc1 Complex Inhibited By An Iodi 1e-70
3cwb_E196 Chicken Cytochrome Bc1 Complex Inhibited By An Iodi 1e-24
1bcc_E196 Cytochrome Bc1 Complex From Chicken Length = 196 1e-70
1bcc_E196 Cytochrome Bc1 Complex From Chicken Length = 196 4e-24
1ezv_E185 Structure Of The Yeast Cytochrome Bc1 Complex Co- C 5e-60
1ezv_E185 Structure Of The Yeast Cytochrome Bc1 Complex Co- C 8e-18
1rie_A129 Structure Of A Water Soluble Fragment Of The Rieske 2e-54
1rie_A129 Structure Of A Water Soluble Fragment Of The Rieske 2e-08
1zrt_E191 Rhodobacter Capsulatus Cytochrome Bc1 Complex With 4e-39
1zrt_E 191 Rhodobacter Capsulatus Cytochrome Bc1 Complex With 2e-09
2yiu_C190 X-Ray Structure Of The Dimeric Cytochrome Bc1 Compl 6e-38
2yiu_C 190 X-Ray Structure Of The Dimeric Cytochrome Bc1 Compl 2e-06
2qjp_C179 Crystal Structure Of Wild Type Rhodobacter Sphaeroi 3e-34
2qjp_C 179 Crystal Structure Of Wild Type Rhodobacter Sphaeroi 1e-04
2fyn_C187 Crystal Structure Analysis Of The Double Mutant Rho 1e-33
2fyn_C 187 Crystal Structure Analysis Of The Double Mutant Rho 1e-04
2qjk_C179 Crystal Structure Analysis Of Mutant Rhodobacter Sp 1e-33
2qjk_C 179 Crystal Structure Analysis Of Mutant Rhodobacter Sp 1e-04
2nuk_A141 Soluble Domain Of The Rieske Iron-Sulfur Protein Fr 7e-31
2nvg_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 1e-30
2nve_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 1e-30
2num_A141 Soluble Domain Of Rieske Iron-Sulfur Protein Length 2e-30
2nvf_A141 Soluble Domain Of Rieske Iron-Sulfur Protein Length 2e-30
2nwf_A141 Soluble Domain Of Rieske Iron Sulfur Protein Length 3e-30
1vf5_D179 Crystal Structure Of Cytochrome B6f Complex From M. 1e-11
2e74_D179 Crystal Structure Of The Cytochrome B6f Complex Fro 3e-11
2zt9_D179 Crystal Structure Of The Cytochrome B6f Complex Fro 6e-11
1rfs_A139 Rieske Soluble Fragment From Spinach Length = 139 3e-09
1q90_C127 Structure Of The Cytochrome B6f (Plastohydroquinone 2e-08
3azc_A133 Crystal Structure Of The Soluble Part Of Cytochrome 6e-08
>pdb|1QCR|E Chain E, Crystal Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex, Alpha Carbon Atoms Only Length = 196 Back     alignment and structure

Iteration: 1

Score = 265 bits (678), Expect = 2e-71, Method: Compositional matrix adjust. Identities = 119/194 (61%), Positives = 151/194 (77%), Gaps = 4/194 (2%) Query: 3 AHSDIRTPDFSKYRR----DRNPDKGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFIS 58 +H+DI+ PDFS YRR D + RK F+Y++ ++V AK+VV+QF+S Sbjct: 1 SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVS 60 Query: 59 SMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDP 118 SMSASADVLAM+ IE+ L+ IPEG+++ FKWRGKPLF+RHRT+KEID E +SQLRDP Sbjct: 61 SMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDP 120 Query: 119 QADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNM 178 Q D +RVK P W+++IG+CTHLGCVPIANAGD+GGYYCPCHGSHYDASGRIRKGPAP N+ Sbjct: 121 QHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNL 180 Query: 179 EVPPYQFGDEGILI 192 EVP Y+F + ++I Sbjct: 181 EVPSYEFTSDDMVI 194
>pdb|1QCR|E Chain E, Crystal Structure Of Bovine Mitochondrial Cytochrome Bc1 Complex, Alpha Carbon Atoms Only Length = 196 Back     alignment and structure
>pdb|3CWB|E Chain E, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-d Length = 196 Back     alignment and structure
>pdb|3CWB|E Chain E, Chicken Cytochrome Bc1 Complex Inhibited By An Iodinated Analogue Of The Polyketide Crocacin-d Length = 196 Back     alignment and structure
>pdb|1BCC|E Chain E, Cytochrome Bc1 Complex From Chicken Length = 196 Back     alignment and structure
>pdb|1BCC|E Chain E, Cytochrome Bc1 Complex From Chicken Length = 196 Back     alignment and structure
>pdb|1EZV|E Chain E, Structure Of The Yeast Cytochrome Bc1 Complex Co- Crystallized With An Antibody Fv-Fragment Length = 185 Back     alignment and structure
>pdb|1EZV|E Chain E, Structure Of The Yeast Cytochrome Bc1 Complex Co- Crystallized With An Antibody Fv-Fragment Length = 185 Back     alignment and structure
>pdb|1RIE|A Chain A, Structure Of A Water Soluble Fragment Of The Rieske Iron- Sulfur Protein Of The Bovine Heart Mitochondrial Cytochrome Bc1-complex Length = 129 Back     alignment and structure
>pdb|1RIE|A Chain A, Structure Of A Water Soluble Fragment Of The Rieske Iron- Sulfur Protein Of The Bovine Heart Mitochondrial Cytochrome Bc1-complex Length = 129 Back     alignment and structure
>pdb|1ZRT|E Chain E, Rhodobacter Capsulatus Cytochrome Bc1 Complex With Stigmatellin Bound Length = 191 Back     alignment and structure
>pdb|1ZRT|E Chain E, Rhodobacter Capsulatus Cytochrome Bc1 Complex With Stigmatellin Bound Length = 191 Back     alignment and structure
>pdb|2YIU|C Chain C, X-Ray Structure Of The Dimeric Cytochrome Bc1 Complex From The Soil Bacterium Paracoccus Denitrificans At 2.7 Angstrom Resolution Length = 190 Back     alignment and structure
>pdb|2YIU|C Chain C, X-Ray Structure Of The Dimeric Cytochrome Bc1 Complex From The Soil Bacterium Paracoccus Denitrificans At 2.7 Angstrom Resolution Length = 190 Back     alignment and structure
>pdb|2QJP|C Chain C, Crystal Structure Of Wild Type Rhodobacter Sphaeroides With Stigmatellin And Antimycin Inhibited Length = 179 Back     alignment and structure
>pdb|2QJP|C Chain C, Crystal Structure Of Wild Type Rhodobacter Sphaeroides With Stigmatellin And Antimycin Inhibited Length = 179 Back     alignment and structure
>pdb|2FYN|C Chain C, Crystal Structure Analysis Of The Double Mutant Rhodobacter Sphaeroides Bc1 Complex Length = 187 Back     alignment and structure
>pdb|2FYN|C Chain C, Crystal Structure Analysis Of The Double Mutant Rhodobacter Sphaeroides Bc1 Complex Length = 187 Back     alignment and structure
>pdb|2QJK|C Chain C, Crystal Structure Analysis Of Mutant Rhodobacter Sphaeroides Bc1 With Stigmatellin And Antimycin Length = 179 Back     alignment and structure
>pdb|2QJK|C Chain C, Crystal Structure Analysis Of Mutant Rhodobacter Sphaeroides Bc1 With Stigmatellin And Antimycin Length = 179 Back     alignment and structure
>pdb|2NUK|A Chain A, Soluble Domain Of The Rieske Iron-Sulfur Protein From Rhodobacter Sphaeroides Length = 141 Back     alignment and structure
>pdb|2NVG|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NVE|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NUM|A Chain A, Soluble Domain Of Rieske Iron-Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NVF|A Chain A, Soluble Domain Of Rieske Iron-Sulfur Protein Length = 141 Back     alignment and structure
>pdb|2NWF|A Chain A, Soluble Domain Of Rieske Iron Sulfur Protein Length = 141 Back     alignment and structure
>pdb|1VF5|D Chain D, Crystal Structure Of Cytochrome B6f Complex From M.Laminosus Length = 179 Back     alignment and structure
>pdb|2E74|D Chain D, Crystal Structure Of The Cytochrome B6f Complex From M.Laminosus Length = 179 Back     alignment and structure
>pdb|2ZT9|D Chain D, Crystal Structure Of The Cytochrome B6f Complex From Nostoc Sp. Pcc 7120 Length = 179 Back     alignment and structure
>pdb|1RFS|A Chain A, Rieske Soluble Fragment From Spinach Length = 139 Back     alignment and structure
>pdb|1Q90|C Chain C, Structure Of The Cytochrome B6f (Plastohydroquinone : Plastocyanin Oxidoreductase) From Chlamydomonas Reinhardtii Length = 127 Back     alignment and structure
>pdb|3AZC|A Chain A, Crystal Structure Of The Soluble Part Of Cytochrome B6f Complex Iron- Sulfur Subunit From Thermosynechococcus Elongatus Bp-1 Length = 133 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
1pp9_E196 Ubiquinol-cytochrome C reductase iron-sulfur SUBU 2e-82
1pp9_E196 Ubiquinol-cytochrome C reductase iron-sulfur SUBU 2e-34
3cx5_E185 Cytochrome B-C1 complex subunit rieske, mitochondr 4e-77
3cx5_E185 Cytochrome B-C1 complex subunit rieske, mitochondr 4e-27
2qjy_C187 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 3e-65
2qjy_C 187 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 3e-19
1rie_A129 Rieske iron-sulfur protein; oxidoreductase, cytoch 1e-62
1rie_A129 Rieske iron-sulfur protein; oxidoreductase, cytoch 3e-13
2nwf_A141 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 3e-61
2nwf_A 141 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 2e-12
3azc_A133 Cytochrome B6-F complex iron-sulfur subunit; riesk 3e-51
3azc_A 133 Cytochrome B6-F complex iron-sulfur subunit; riesk 7e-05
1vf5_D179 Rieske iron-sulfur protein; photosynthesis, membra 4e-46
1nyk_A165 Rieske iron-sulfur protein; beta barrel, iron sulf 5e-40
1rfs_A139 Rieske protein; iron-sulfur protein, electron tran 1e-31
1jm1_A204 Rieske iron-sulfur protein SOXF; electron transpor 3e-17
1g8k_B133 Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, 1e-11
>1pp9_E Ubiquinol-cytochrome C reductase iron-sulfur SUBU mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: b.33.1.1 f.23.12.1 PDB: 1bgy_E* 1be3_E* 1l0n_E* 1ntk_E* 1ntm_E* 1ntz_E* 1nu1_E* 1l0l_E* 1ppj_E* 1qcr_E* 1sqb_E* 1sqp_E* 1sqq_E* 1sqv_E* 1sqx_E* 2a06_E* 2fyu_E* 2ybb_E* 1bcc_E* 2bcc_E* ... Length = 196 Back     alignment and structure
 Score =  245 bits (627), Expect = 2e-82
 Identities = 119/194 (61%), Positives = 151/194 (77%), Gaps = 4/194 (2%)

Query: 3   AHSDIRTPDFSKYRRDRNPD----KGQEETQRKAFTYMIAGGSSVVGMVCAKSVVNQFIS 58
           +H+DI+ PDFS YRR    D      +    RK F+Y++   ++V     AK+VV+QF+S
Sbjct: 1   SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVS 60

Query: 59  SMSASADVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDP 118
           SMSASADVLAM+ IE+ L+ IPEG+++ FKWRGKPLF+RHRT+KEID E    +SQLRDP
Sbjct: 61  SMSASADVLAMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDP 120

Query: 119 QADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNM 178
           Q D +RVK P W+++IG+CTHLGCVPIANAGD+GGYYCPCHGSHYDASGRIRKGPAP N+
Sbjct: 121 QHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNL 180

Query: 179 EVPPYQFGDEGILI 192
           EVP Y+F  + ++I
Sbjct: 181 EVPSYEFTSDDMVI 194


>1pp9_E Ubiquinol-cytochrome C reductase iron-sulfur SUBU mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: b.33.1.1 f.23.12.1 PDB: 1bgy_E* 1be3_E* 1l0n_E* 1ntk_E* 1ntm_E* 1ntz_E* 1nu1_E* 1l0l_E* 1ppj_E* 1qcr_E* 1sqb_E* 1sqp_E* 1sqq_E* 1sqv_E* 1sqx_E* 2a06_E* 2fyu_E* 2ybb_E* 1bcc_E* 2bcc_E* ... Length = 196 Back     alignment and structure
>3cx5_E Cytochrome B-C1 complex subunit rieske, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: b.33.1.1 f.23.12.1 PDB: 1kb9_E* 1kyo_E* 1p84_E* 2ibz_E* 1ezv_E* 3cxh_E* Length = 185 Back     alignment and structure
>3cx5_E Cytochrome B-C1 complex subunit rieske, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: b.33.1.1 f.23.12.1 PDB: 1kb9_E* 1kyo_E* 1p84_E* 2ibz_E* 1ezv_E* 3cxh_E* Length = 185 Back     alignment and structure
>2qjy_C Ubiquinol-cytochrome C reductase iron-sulfur SUBU; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix 1 N-TERM TM helix; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_C* 2qjk_C* 2qjp_C* 1zrt_E* 2yiu_C* Length = 187 Back     alignment and structure
>2qjy_C Ubiquinol-cytochrome C reductase iron-sulfur SUBU; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix 1 N-TERM TM helix; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_C* 2qjk_C* 2qjp_C* 1zrt_E* 2yiu_C* Length = 187 Back     alignment and structure
>1rie_A Rieske iron-sulfur protein; oxidoreductase, cytochrome BC1 complex, histidine ligands, rieske iron-sulfur cluster, electron transport; 1.50A {Bos taurus} SCOP: b.33.1.1 Length = 129 Back     alignment and structure
>1rie_A Rieske iron-sulfur protein; oxidoreductase, cytochrome BC1 complex, histidine ligands, rieske iron-sulfur cluster, electron transport; 1.50A {Bos taurus} SCOP: b.33.1.1 Length = 129 Back     alignment and structure
>2nwf_A Ubiquinol-cytochrome C reductase iron-sulfur SUBU; rieske [2Fe-2S] ISP, oxidoreductase; HET: GOL; 1.10A {Rhodobacter sphaeroides} PDB: 2nuk_A 2nve_A 2num_A 2nvg_A 2nvf_A Length = 141 Back     alignment and structure
>2nwf_A Ubiquinol-cytochrome C reductase iron-sulfur SUBU; rieske [2Fe-2S] ISP, oxidoreductase; HET: GOL; 1.10A {Rhodobacter sphaeroides} PDB: 2nuk_A 2nve_A 2num_A 2nvg_A 2nvf_A Length = 141 Back     alignment and structure
>3azc_A Cytochrome B6-F complex iron-sulfur subunit; rieske, thermosynechococcus elongatu photosynthesis, electron transport; 2.00A {Thermosynechococcus elongatus} Length = 133 Back     alignment and structure
>3azc_A Cytochrome B6-F complex iron-sulfur subunit; rieske, thermosynechococcus elongatu photosynthesis, electron transport; 2.00A {Thermosynechococcus elongatus} Length = 133 Back     alignment and structure
>1vf5_D Rieske iron-sulfur protein; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: b.33.1.1 f.23.12.1 PDB: 2d2c_D* 2e74_D* 2e75_D* 2e76_D* 2zt9_D* Length = 179 Back     alignment and structure
>1nyk_A Rieske iron-sulfur protein; beta barrel, iron sulfur cluster, electron transport; 1.31A {Thermus thermophilus} SCOP: b.33.1.1 PDB: 3fou_A Length = 165 Back     alignment and structure
>1rfs_A Rieske protein; iron-sulfur protein, electron transport; 1.83A {Spinacia oleracea} SCOP: b.33.1.1 PDB: 1q90_C* Length = 139 Back     alignment and structure
>1jm1_A Rieske iron-sulfur protein SOXF; electron transport, respiratory chain, oxidoreductase; 1.11A {Sulfolobus acidocaldarius} SCOP: b.33.1.1 Length = 204 Back     alignment and structure
>1g8k_B Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.33.1.1 PDB: 1g8j_B* Length = 133 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
1pp9_E196 Ubiquinol-cytochrome C reductase iron-sulfur SUBU 100.0
3cx5_E185 Cytochrome B-C1 complex subunit rieske, mitochondr 100.0
2qjy_C187 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 100.0
2nwf_A141 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 100.0
1rie_A129 Rieske iron-sulfur protein; oxidoreductase, cytoch 99.97
1vf5_D179 Rieske iron-sulfur protein; photosynthesis, membra 99.95
4aay_B175 AROB; oxidoreductase, rieske, iron sulfur, molybdo 99.91
1pp9_E196 Ubiquinol-cytochrome C reductase iron-sulfur SUBU 99.91
1nyk_A165 Rieske iron-sulfur protein; beta barrel, iron sulf 99.9
3gce_A121 Ferredoxin component of carbazole 1,9A- dioxygenas 99.87
3cx5_E185 Cytochrome B-C1 complex subunit rieske, mitochondr 99.87
2qpz_A103 Naphthalene 1,2-dioxygenase system ferredoxin subu 99.87
3dqy_A106 Toluene 1,2-dioxygenase system ferredoxin subunit; 99.86
1fqt_A112 Rieske-type ferredoxin of biphenyl dioxygenase; 2F 99.86
2i7f_A108 Ferredoxin component of dioxygenase; rieske ferred 99.85
1g8k_B133 Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, 99.85
1vm9_A111 Toluene-4-monooxygenase system protein C; structur 99.85
2de6_D115 Ferredoxin component of carbazole; electron transf 99.84
1rfs_A139 Rieske protein; iron-sulfur protein, electron tran 99.83
1jm1_A204 Rieske iron-sulfur protein SOXF; electron transpor 99.82
3c0d_A119 Putative nitrite reductase NADPH (small subunit) o 99.8
2jo6_A113 Nitrite reductase [NAD(P)H] small subunit; all bet 99.8
2jza_A130 Nitrite reductase [NAD(P)H] small subunit; ISP dom 99.79
3azc_A133 Cytochrome B6-F complex iron-sulfur subunit; riesk 99.63
4aiv_A119 Probable nitrite reductase [NAD(P)H] small subuni; 99.75
3d89_A157 Rieske domain-containing protein; CAsp target, rie 99.69
2qjy_C 187 Ubiquinol-cytochrome C reductase iron-sulfur SUBU; 99.69
2zyl_A 386 Possible oxidoreductase; KSHA, cholesterol, rieske 99.69
3gke_A 349 DDMC; rieske cluster, non-heme mononuclear iron, o 99.68
3gkq_A 389 Terminal oxygenase component of carbazole 1,9A- di 99.65
3gcf_A 394 Terminal oxygenase component of carbazole 1,9A- di 99.64
3vca_A 412 Ring-hydroxylating dioxygenase; rieske-type, monon 99.63
3n0q_A 409 Putative aromatic-ring hydroxylating dioxygenase; 99.62
2gbw_A 454 Biphenyl 2,3-dioxygenase alpha subunit; rieske oxy 99.62
2bmo_A 447 Oxygenase-alpha NBDO; nitrobenzene dioxygenase, ni 99.61
2de6_A 392 Terminal oxygenase component of carbazole; electro 99.59
1z01_A 446 2-OXO-1,2-dihydroquinoline 8-monooxygenase, oxygen 99.58
2b1x_A 470 Naphthalene dioxygenase large subunit; rieske non- 99.58
1uli_A 460 Biphenyl dioxygenase large subunit; alpha3 BETA3 h 99.58
3gzx_A 457 Biphenyl dioxygenase subunit alpha; rieskie, non-h 99.52
1vf5_D179 Rieske iron-sulfur protein; photosynthesis, membra 98.52
4aay_B175 AROB; oxidoreductase, rieske, iron sulfur, molybdo 95.6
1q90_R49 Cytochrome B6-F complex iron-sulfur subunit; membr 85.66
1q90_R49 Cytochrome B6-F complex iron-sulfur subunit; membr 83.39
>1pp9_E Ubiquinol-cytochrome C reductase iron-sulfur SUBU mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: b.33.1.1 f.23.12.1 PDB: 1bgy_E* 1be3_E* 1l0n_E* 1ntk_E* 1ntm_E* 1ntz_E* 1nu1_E* 1l0l_E* 1ppj_E* 1qcr_E* 1sqb_E* 1sqp_E* 1sqq_E* 1sqv_E* 1sqx_E* 2a06_E* 2fyu_E* 2ybb_E* 1bcc_E* 2bcc_E* ... Back     alignment and structure
Probab=100.00  E-value=1.5e-48  Score=343.97  Aligned_cols=190  Identities=63%  Similarity=1.161  Sum_probs=176.7

Q ss_pred             CCCCCCCCCccccccCCCCC--CCCC--CcCchhhHHHHHHhHHHHHHHHHHHHHHHhhcCCCcchhhhccccceeecCC
Q psy6642           3 AHSDIRTPDFSKYRRDRNPD--KGQE--ETQRKAFTYMIAGGSSVVGMVCAKSVVNQFISSMSASADVLAMATIEVDLNL   78 (292)
Q Consensus         3 ~~~~~~~pd~~~yr~~~~~~--~~~~--~~~RR~fl~~atG~~~~~g~~aA~~~~~~~i~~~~p~a~~~a~~~~~v~~s~   78 (292)
                      +|||+.+|||++||+.+++|  ++++  +.+||+|+|+++|+++++|++++..++.+|+.+++|+++.++.+.+++++++
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~RR~fl~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~a~~~v~v~ls~   80 (196)
T 1pp9_E            1 SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIEIKLSD   80 (196)
T ss_dssp             CGGGCCCCCCTTTBCGGGCCTTSCTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCHHHHCCCCEEEEGGG
T ss_pred             CCCCcCCCCchHhhcccccCcccccccCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCCCcccccccccEEEHHH
Confidence            79999999999999999888  3332  6789999999999988888888888999999999999999988899999999


Q ss_pred             CCCCCeEEEEEcCeeEEEEeCChhhhhhcccccccccCCCCcccccccCCCeEEEEecccCCCcccCCcCCCCCeEEcCC
Q psy6642          79 IPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDPQADSDRVKDPSWLVIIGICTHLGCVPIANAGDWGGYYCPC  158 (292)
Q Consensus        79 l~~g~~~~~~~~g~pv~i~~~t~~~i~~~~~v~~~~l~dp~~~~~R~~~g~~~a~~~~CtHlGc~l~~~~~~~~~~~CPc  158 (292)
                      |++|+.++++|+|+|++|+++++++|+...++....++||+...+|..+++|+|++++|||+||+|.++.++++.|+|||
T Consensus        81 l~~G~~~~v~~~G~pV~V~r~t~~~i~~~~~~~~~~l~dp~~~~~r~~~ge~~a~~~~CtH~G~~l~~~~~~~~~~~CP~  160 (196)
T 1pp9_E           81 IPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPC  160 (196)
T ss_dssp             SCTTCEEEEEETTEEEEEEECCHHHHHHHHHSCTTTCSSCCCGGGTCSSTTEEEEECCCTTTSCCCEETCSTTSSEEETT
T ss_pred             CCCCCeEEEEECCEEEEEEECCHHHHhhhhccccccccCcccccccccCCeEEEEECccCCCCeeccccCCCCCEEEeCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999887778999999


Q ss_pred             CCcEEcCCCceecCCCCCCCCCCceEe-ecCceEE
Q psy6642         159 HGSHYDASGRIRKGPAPTNMEVPPYQF-GDEGILI  192 (292)
Q Consensus       159 HGs~FD~~G~v~~gPa~~~L~~~p~~~-~~d~i~V  192 (292)
                      |||+||++|+++.||++.+|++||+++ +++.|+|
T Consensus       161 HGs~FD~~G~v~~gPa~~~L~~~p~~v~~d~~I~v  195 (196)
T 1pp9_E          161 HGSHYDASGRIRKGPAPLNLEVPSYEFTSDDMVIV  195 (196)
T ss_dssp             TTEEECTTCCEEESSCCSCCCCCCEEEETTTEEEE
T ss_pred             CCCEECCCCCCccCCCCCCCcceeEEEEECCEEEE
Confidence            999999999999999999999999999 6776654



>3cx5_E Cytochrome B-C1 complex subunit rieske, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: b.33.1.1 f.23.12.1 PDB: 1kb9_E* 1kyo_E* 1p84_E* 2ibz_E* 1ezv_E* 3cxh_E* Back     alignment and structure
>2qjy_C Ubiquinol-cytochrome C reductase iron-sulfur SUBU; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix 1 N-TERM TM helix; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_C* 2qjk_C* 2qjp_C* 1zrt_E* 2yiu_C* Back     alignment and structure
>2nwf_A Ubiquinol-cytochrome C reductase iron-sulfur SUBU; rieske [2Fe-2S] ISP, oxidoreductase; HET: GOL; 1.10A {Rhodobacter sphaeroides} PDB: 2nuk_A 2nve_A 2num_A 2nvg_A 2nvf_A Back     alignment and structure
>1rie_A Rieske iron-sulfur protein; oxidoreductase, cytochrome BC1 complex, histidine ligands, rieske iron-sulfur cluster, electron transport; 1.50A {Bos taurus} SCOP: b.33.1.1 Back     alignment and structure
>1vf5_D Rieske iron-sulfur protein; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: b.33.1.1 f.23.12.1 PDB: 2d2c_D* 2e74_D* 2e75_D* 2e76_D* 2zt9_D* Back     alignment and structure
>4aay_B AROB; oxidoreductase, rieske, iron sulfur, molybdopterin; HET: MGD; 2.70A {Rhizobium species} Back     alignment and structure
>1pp9_E Ubiquinol-cytochrome C reductase iron-sulfur SUBU mitochondrial; cytochrome BC1, membrane protein, heme protein, rieske iron protein, cytochrome B, complex III; HET: BHG HEM HEC SMA UQ CDL PEE; 2.10A {Bos taurus} SCOP: b.33.1.1 f.23.12.1 PDB: 1bgy_E* 1be3_E* 1l0n_E* 1ntk_E* 1ntm_E* 1ntz_E* 1nu1_E* 1l0l_E* 1ppj_E* 1qcr_E* 1sqb_E* 1sqp_E* 1sqq_E* 1sqv_E* 1sqx_E* 2a06_E* 2fyu_E* 2ybb_E* 1bcc_E* 2bcc_E* ... Back     alignment and structure
>1nyk_A Rieske iron-sulfur protein; beta barrel, iron sulfur cluster, electron transport; 1.31A {Thermus thermophilus} SCOP: b.33.1.1 PDB: 3fou_A Back     alignment and structure
>3gce_A Ferredoxin component of carbazole 1,9A- dioxygenase; rieske ferredoxin, 2Fe-2S, electron transfer, oxidoreductase; 2.00A {Nocardioides aromaticivorans} Back     alignment and structure
>3cx5_E Cytochrome B-C1 complex subunit rieske, mitochondrial; complex III, electron transfer complex, cytochrome BC1 complex, mitochondrialtransmembrane complex; HET: M3L SUC 6PH UMQ HEM SMA 8PE 9PE CN5 7PH CN3; 1.90A {Saccharomyces cerevisiae} SCOP: b.33.1.1 f.23.12.1 PDB: 1kb9_E* 1kyo_E* 1p84_E* 2ibz_E* 1ezv_E* 3cxh_E* Back     alignment and structure
>2qpz_A Naphthalene 1,2-dioxygenase system ferredoxin subunit; rieske ferredoxin, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport, iron; 1.85A {Pseudomonas putida} Back     alignment and structure
>3dqy_A Toluene 1,2-dioxygenase system ferredoxin subunit; rieske, iron-sulfur cluster, 2Fe-2S, aromatic hydrocarbons catabolism, electron transport; 1.20A {Pseudomonas putida} SCOP: b.33.1.0 PDB: 4emj_B* Back     alignment and structure
>1fqt_A Rieske-type ferredoxin of biphenyl dioxygenase; 2Fe-2S cluster, beta sandwich, oxido; 1.60A {Burkholderia xenovorans} SCOP: b.33.1.1 PDB: 2e4q_A 2e4p_A 2yvj_B* Back     alignment and structure
>2i7f_A Ferredoxin component of dioxygenase; rieske ferredoxin, oxidoreductase; HET: CIT; 1.90A {Sphingobium yanoikuyae} Back     alignment and structure
>1g8k_B Arsenite oxidase; molybdopterin, [3Fe-4S] cluster, [2Fe-2S] rieske, oxidoreductase; HET: MGD; 1.64A {Alcaligenes faecalis} SCOP: b.33.1.1 PDB: 1g8j_B* Back     alignment and structure
>1vm9_A Toluene-4-monooxygenase system protein C; structural genomics, CESG, protein structure initiative, PSI, ferredoxin, FES, [2Fe-2S] cluster; 1.48A {Pseudomonas mendocina} SCOP: b.33.1.1 PDB: 2q3w_A 1sjg_A Back     alignment and structure
>2de6_D Ferredoxin component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Pseudomonas resinovorans} PDB: 2de5_D 1vck_A 2de7_D* Back     alignment and structure
>1rfs_A Rieske protein; iron-sulfur protein, electron transport; 1.83A {Spinacia oleracea} SCOP: b.33.1.1 PDB: 1q90_C* Back     alignment and structure
>1jm1_A Rieske iron-sulfur protein SOXF; electron transport, respiratory chain, oxidoreductase; 1.11A {Sulfolobus acidocaldarius} SCOP: b.33.1.1 Back     alignment and structure
>3c0d_A Putative nitrite reductase NADPH (small subunit) oxidoreductase protein; NESG, VPR162, Q87HB1, XRAY, structure; 2.40A {Vibrio parahaemolyticus rimd 2210633} SCOP: b.33.1.3 Back     alignment and structure
>2jo6_A Nitrite reductase [NAD(P)H] small subunit; all beta, ISP domain, rieske iron-sulfur protein, 3-layer sandwich, structural genomics, PSI-2; NMR {Escherichia coli} SCOP: b.33.1.3 Back     alignment and structure
>2jza_A Nitrite reductase [NAD(P)H] small subunit; ISP domain, rieske iron-sulfur protein, 3-layer beta- sandwich; NMR {Pectobacterium atrosepticum SCRI1043} SCOP: b.33.1.3 Back     alignment and structure
>3azc_A Cytochrome B6-F complex iron-sulfur subunit; rieske, thermosynechococcus elongatu photosynthesis, electron transport; 2.00A {Thermosynechococcus elongatus} Back     alignment and structure
>4aiv_A Probable nitrite reductase [NAD(P)H] small subuni; oxidoreductase, nitrite metabolism; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3d89_A Rieske domain-containing protein; CAsp target, rieske ferredoxin, [2Fe-2S] cluster, protein ST initiative, PSI; 2.07A {Mus musculus} Back     alignment and structure
>2qjy_C Ubiquinol-cytochrome C reductase iron-sulfur SUBU; cytochrome B, 8 TM helixces cytochrome C1, 1 C-TERM TM helix 1 N-TERM TM helix; HET: BGL HEM SMA LOP UQ2; 2.40A {Rhodobacter sphaeroides} PDB: 2fyn_C* 2qjk_C* 2qjp_C* 1zrt_E* 2yiu_C* Back     alignment and structure
>2zyl_A Possible oxidoreductase; KSHA, cholesterol, rieske; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3gke_A DDMC; rieske cluster, non-heme mononuclear iron, oxygenase, oxidoreductase; 1.75A {Stenotrophomonas maltophilia} PDB: 3gb4_A 3gl0_A* 3gl2_A* 3gob_A* 3gte_A 3gts_A* Back     alignment and structure
>3gkq_A Terminal oxygenase component of carbazole 1,9A- dioxygenase; rieske nonheme iron oxygenase, electron transfer, putidaredoxin-type ferredoxin; 2.10A {Sphingomonas} Back     alignment and structure
>3gcf_A Terminal oxygenase component of carbazole 1,9A- dioxygenase; rieske oxygenase, 2Fe-2S, electron transfer, oxidoreductase; 2.30A {Nocardioides aromaticivorans} Back     alignment and structure
>3vca_A Ring-hydroxylating dioxygenase; rieske-type, mononuclear non-heme iron, N-demethylase, oxido; 1.59A {Sinorhizobium meliloti} PDB: 3vcp_A Back     alignment and structure
>3n0q_A Putative aromatic-ring hydroxylating dioxygenase; rieske [2Fe-2S] domain, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.80A {Ruegeria SP} Back     alignment and structure
>2gbw_A Biphenyl 2,3-dioxygenase alpha subunit; rieske oxygenase, oxidoreductase, non heme iron; 1.70A {Sphingobium yanoikuyae} PDB: 2gbx_A* 2ckf_A Back     alignment and structure
>2bmo_A Oxygenase-alpha NBDO; nitrobenzene dioxygenase, nitroarene, rieske non-heme dioxygenase, substrate specificity iron- sulfur, metal-binding, NAD; 1.2A {Comamonas SP} SCOP: b.33.1.2 d.129.3.3 PDB: 2bmq_A 2bmr_A* 2hmj_A 2hml_A* 2hmn_A* 1o7n_A 1ndo_A 1o7g_A* 1o7h_A 1o7m_A 1eg9_A 1o7p_A* 1o7w_A 1uuv_A 1uuw_A 2hmk_A* 2hmm_A* 2hmo_A* Back     alignment and structure
>2de6_A Terminal oxygenase component of carbazole; electron transfer complex, rieske non-heme iron oxygenase system, terminal oxygenase; 1.80A {Janthinobacterium} SCOP: b.33.1.2 d.129.3.3 PDB: 1ww9_A 2de5_A 2de7_A* Back     alignment and structure
>1z01_A 2-OXO-1,2-dihydroquinoline 8-monooxygenase, oxygenase component; rieske center, oxygen binding/activation, substrate bound complex; 1.80A {Pseudomonas putida} SCOP: b.33.1.2 d.129.3.3 PDB: 1z02_A 1z03_A* Back     alignment and structure
>2b1x_A Naphthalene dioxygenase large subunit; rieske non-heme iron oxygenase, oxidoreductase; 2.00A {Rhodococcus SP} SCOP: b.33.1.2 d.129.3.3 PDB: 2b24_A Back     alignment and structure
>1uli_A Biphenyl dioxygenase large subunit; alpha3 BETA3 hetero hexamer, oxidoreductase; 2.20A {Rhodococcus SP} SCOP: b.33.1.2 d.129.3.3 PDB: 1ulj_A* 3en1_A* 3eqq_A Back     alignment and structure
>3gzx_A Biphenyl dioxygenase subunit alpha; rieskie, non-heme iron, 2Fe-2S, aromatic hydroc catabolism, iron, iron-sulfur, metal-binding, NAD; HET: BNL MES; 1.58A {Comamonas testosteroni} PDB: 3gzy_A* 1wql_A 2xso_A 2xsh_A 2xrx_A* 2xr8_A* 2yfi_A 2yfj_A* 2yfl_A* Back     alignment and structure
>1vf5_D Rieske iron-sulfur protein; photosynthesis, membrane protein complex, electron transfer complex; HET: HEM TDS PL9 OPC CLA BCR; 3.00A {Mastigocladus laminosus} SCOP: b.33.1.1 f.23.12.1 PDB: 2d2c_D* 2e74_D* 2e75_D* 2e76_D* 2zt9_D* Back     alignment and structure
>4aay_B AROB; oxidoreductase, rieske, iron sulfur, molybdopterin; HET: MGD; 2.70A {Rhizobium species} Back     alignment and structure
>1q90_R Cytochrome B6-F complex iron-sulfur subunit; membrane protein complex, photosynthesis, electron transfer, oxydoreductase, chlorophyll; HET: HEM CL1 BCR TDS SQD LFA LMG; 3.10A {Chlamydomonas reinhardtii} SCOP: f.23.12.1 Back     alignment and structure
>1q90_R Cytochrome B6-F complex iron-sulfur subunit; membrane protein complex, photosynthesis, electron transfer, oxydoreductase, chlorophyll; HET: HEM CL1 BCR TDS SQD LFA LMG; 3.10A {Chlamydomonas reinhardtii} SCOP: f.23.12.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 292
d1riea_127 b.33.1.1 (A:) ISP subunit of the mitochondrial cyt 2e-52
d1riea_127 b.33.1.1 (A:) ISP subunit of the mitochondrial cyt 1e-10
d3cx5e1129 b.33.1.1 (E:87-215) ISP subunit of the mitochondri 2e-49
d3cx5e1129 b.33.1.1 (E:87-215) ISP subunit of the mitochondri 4e-12
d1ppje269 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cy 2e-24
d1ppje269 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cy 2e-24
d1nyka_156 b.33.1.1 (A:) Soluble Rieske protein {Thermus ther 2e-21
d1nyka_ 156 b.33.1.1 (A:) Soluble Rieske protein {Thermus ther 6e-05
d3cx5e256 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of c 1e-18
d3cx5e256 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of c 1e-18
d1rfsa_127 b.33.1.1 (A:) ISP subunit from chloroplast cytochr 3e-16
d1jm1a_202 b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon S 2e-15
d2e74d1134 b.33.1.1 (D:46-179) ISP subunit from the cytochrom 2e-14
d1g8kb_133 b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alc 8e-09
d1vm9a_109 b.33.1.1 (A:) Toluene-4-monooxygenase system prote 0.002
>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} Length = 127 Back     information, alignment and structure

class: All beta proteins
fold: ISP domain
superfamily: ISP domain
family: Rieske iron-sulfur protein (ISP)
domain: ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain
species: Cow (Bos taurus) [TaxId: 9913]
 Score =  165 bits (419), Expect = 2e-52
 Identities = 87/125 (69%), Positives = 107/125 (85%)

Query: 68  AMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDPQADSDRVKD 127
           AM+ IE+ L+ IPEG+++ FKWRGKPLF+RHRT+KEID E    +SQLRDPQ D +RVK 
Sbjct: 1   AMSKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTKKEIDQEAAVEVSQLRDPQHDLERVKK 60

Query: 128 PSWLVIIGICTHLGCVPIANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGD 187
           P W+++IG+CTHLGCVPIANAGD+GGYYCPCHGSHYDASGRIRKGPAP N+EVP Y+F  
Sbjct: 61  PEWVILIGVCTHLGCVPIANAGDFGGYYCPCHGSHYDASGRIRKGPAPLNLEVPSYEFTS 120

Query: 188 EGILI 192
           + ++I
Sbjct: 121 DDMVI 125


>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} Length = 127 Back     information, alignment and structure
>d3cx5e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 129 Back     information, alignment and structure
>d3cx5e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 129 Back     information, alignment and structure
>d1ppje2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} Length = 69 Back     information, alignment and structure
>d1ppje2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} Length = 69 Back     information, alignment and structure
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]} Length = 156 Back     information, alignment and structure
>d3cx5e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d3cx5e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1rfsa_ b.33.1.1 (A:) ISP subunit from chloroplast cytochrome bf complex {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 127 Back     information, alignment and structure
>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 202 Back     information, alignment and structure
>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} Length = 134 Back     information, alignment and structure
>d1g8kb_ b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]} Length = 133 Back     information, alignment and structure
>d1vm9a_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]} Length = 109 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
d3cx5e1129 ISP subunit of the mitochondrial cytochrome bc1-co 100.0
d1riea_127 ISP subunit of the mitochondrial cytochrome bc1-co 100.0
d1nyka_156 Soluble Rieske protein {Thermus thermophilus [TaxI 99.88
d1rfsa_127 ISP subunit from chloroplast cytochrome bf complex 99.85
d2e74d1134 ISP subunit from the cytochrome b6f complex, solub 99.85
d1g8kb_133 Arsenite oxidase Rieske subunit {Alcaligenes faeca 99.82
d1fqta_109 Rieske-type ferredoxin associated with biphenyl di 99.82
d3c0da1108 NADH-nitrite reductase small subunit NirD {Vibrio 99.81
d1vm9a_109 Toluene-4-monooxygenase system protein C, TmoC {Ps 99.8
d1jm1a_202 Rieske protein II (SoxF) {Archaeon Sulfolobus acid 99.78
d2jo6a1108 NADH-nitrite reductase small subunit NirD {Escheri 99.76
d2jzaa1122 NADH-nitrite reductase small subunit NirD {Erwinia 99.75
d1z01a1148 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygen 99.73
d2de6a1142 Terminal oxygenase component of carbazole CarAa {J 99.71
d1ppje269 Iron-sulfur subunit (ISP) of cytochrome bc1 comple 99.64
d2b1xa1162 Naphthalene 1,2-dioxygenase alpha subunit, N-domai 99.55
d2bmoa1150 Nitrobenzene dioxygenase alpha subunit, NBDO-alpha 99.54
d1ulia1154 Biphenyl dioxygenase large subunit BphA1, N-termin 99.53
d1ppje269 Iron-sulfur subunit (ISP) of cytochrome bc1 comple 99.49
d3cx5e256 Iron-sulfur subunit (ISP) of cytochrome bc1 comple 99.17
d3cx5e256 Iron-sulfur subunit (ISP) of cytochrome bc1 comple 98.87
d2e74d234 ISP subunit from the cytochrome b6f complex, trans 85.75
d2e74d234 ISP subunit from the cytochrome b6f complex, trans 83.08
>d3cx5e1 b.33.1.1 (E:87-215) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All beta proteins
fold: ISP domain
superfamily: ISP domain
family: Rieske iron-sulfur protein (ISP)
domain: ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=3.5e-37  Score=252.45  Aligned_cols=128  Identities=63%  Similarity=1.283  Sum_probs=121.5

Q ss_pred             hhhccccceeecCCCCCCCeEEEEEcCeeEEEEeCChhhhhhcccccccccCCCCcccccccCCCeEEEEecccCCCccc
Q psy6642          65 DVLAMATIEVDLNLIPEGQSVTFKWRGKPLFIRHRTQKEIDTEQNTNISQLRDPQADSDRVKDPSWLVIIGICTHLGCVP  144 (292)
Q Consensus        65 ~~~a~~~~~v~~s~l~~g~~~~~~~~g~pv~i~~~t~~~i~~~~~v~~~~l~dp~~~~~R~~~g~~~a~~~~CtHlGc~l  144 (292)
                      |++|.+.++||+++|++|++++++|+|+|+||++||+++|+....+....+.+|+....|+.+++|++++++|||+||.+
T Consensus         1 dv~A~a~veVDis~l~pG~~~~V~WrGkPVfI~~Rt~e~i~~~~~~~~~~l~dp~~~~~r~~~~~~~v~~~~CtHlGC~~   80 (129)
T d3cx5e1           1 DVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRHRTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVP   80 (129)
T ss_dssp             GGCCCCCEEEEGGGCCTTCEEEEEETTEEEEEEECCHHHHHHHHCSCGGGCSSCCCSTTTCSSTTEEEEECCCTTTSCCC
T ss_pred             CccccCceEEehhhCCCCCeEEEEeCCceEEEEecCHHHhhhccccccccccccccchhccccccEEEEEeeccCcceee
Confidence            56788999999999999999999999999999999999999988888889999999999999999999999999999999


Q ss_pred             CCcCCCCCeEEcCCCCcEEcCCCceecCCCCCCCCCCceEeecCceEE
Q psy6642         145 IANAGDWGGYYCPCHGSHYDASGRIRKGPAPTNMEVPPYQFGDEGILI  192 (292)
Q Consensus       145 ~~~~~~~~~~~CPcHGs~FD~~G~v~~gPa~~~L~~~p~~~~~d~i~V  192 (292)
                      .+..++.++|+||||||+||.+|++++|||++||++||+++++++++|
T Consensus        81 ~~~~~~~~~~~CPCHgs~fd~~G~v~~GPA~~~L~~~~~~~~~~~i~i  128 (129)
T d3cx5e1          81 IGEAGDFGGWFCPCHGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIV  128 (129)
T ss_dssp             EEEETTTTEEEETTTTEEECTTCCEEESSCCSCCCCCCEEEETTEEEE
T ss_pred             eeccCcCCeEEEcCcCCCCCCCCCEEeCCCCCCCCCCcEEEECCEEEE
Confidence            988777789999999999999999999999999999999999998764



>d1riea_ b.33.1.1 (A:) ISP subunit of the mitochondrial cytochrome bc1-complex, water-soluble domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rfsa_ b.33.1.1 (A:) ISP subunit from chloroplast cytochrome bf complex {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2e74d1 b.33.1.1 (D:46-179) ISP subunit from the cytochrome b6f complex, soluble domain {Mastigocladus laminosus [TaxId: 83541]} Back     information, alignment and structure
>d1g8kb_ b.33.1.1 (B:) Arsenite oxidase Rieske subunit {Alcaligenes faecalis [TaxId: 511]} Back     information, alignment and structure
>d1fqta_ b.33.1.1 (A:) Rieske-type ferredoxin associated with biphenyl dioxygenase {Burkholderia cepacia [TaxId: 292]} Back     information, alignment and structure
>d3c0da1 b.33.1.3 (A:4-111) NADH-nitrite reductase small subunit NirD {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1vm9a_ b.33.1.1 (A:) Toluene-4-monooxygenase system protein C, TmoC {Pseudomonas mendocina [TaxId: 300]} Back     information, alignment and structure
>d1jm1a_ b.33.1.1 (A:) Rieske protein II (SoxF) {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d2jo6a1 b.33.1.3 (A:1-108) NADH-nitrite reductase small subunit NirD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jzaa1 b.33.1.3 (A:1-122) NADH-nitrite reductase small subunit NirD {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1z01a1 b.33.1.2 (A:16-163) 2-oxo-1,2-dihydroquinoline 8-monooxygenase, oxygenase component OxoO {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2de6a1 b.33.1.2 (A:1-142) Terminal oxygenase component of carbazole CarAa {Janthinobacterium sp. j3 [TaxId: 213804]} Back     information, alignment and structure
>d1ppje2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2b1xa1 b.33.1.2 (A:1-162) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Rhodococcus sp. ncimb12038 [TaxId: 92694]} Back     information, alignment and structure
>d2bmoa1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]} Back     information, alignment and structure
>d1ulia1 b.33.1.2 (A:17-170) Biphenyl dioxygenase large subunit BphA1, N-terminal domain {Rhodococcus sp. (strain RHA1) [TaxId: 101510]} Back     information, alignment and structure
>d1ppje2 f.23.12.1 (E:1-69) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3cx5e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3cx5e2 f.23.12.1 (E:31-86) Iron-sulfur subunit (ISP) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane region {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2e74d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]} Back     information, alignment and structure
>d2e74d2 f.23.12.1 (D:12-45) ISP subunit from the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]} Back     information, alignment and structure