Diaphorina citri psyllid: psy664

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MQTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMSLDNNILYPLIDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDASGAQEFTFAGATQGGACDSTTMLAGGGGGFNF
cHHHHHHHcccHHHHHHHcccccccHHccHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHccHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHcccccHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccc
MQTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMSLDNNILYPLIDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDASGAQEFTFAGA*******************N*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMSLDNNILYPLIDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDASGAQEFTFAGATQGGACDSTTMLAGGGGGFNF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Importin subunit alpha-7 Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.very confidentQ5RBV0
Importin subunit alpha-7 Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.very confidentO60684
Importin subunit alpha-B Functions in nuclear protein import via a substrate-importin alpha-beta transport complex that passes though the nuclear pore complexes (NPC). Binds specifically and directly to substrates containing either a simple or bipartite NLS motif.confidentQ76P29

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008565 [MF]protein transporter activityconfidentGO:0005215, GO:0022892, GO:0003674
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processconfidentGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0006607 [BP]NLS-bearing substrate import into nucleusconfidentGO:0034504, GO:0051169, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0006810, GO:0071702, GO:0051641, GO:0017038, GO:0034613, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0051704 [BP]multi-organism processconfidentGO:0008150
GO:0005829 [CC]cytosolconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005515 [MF]protein bindingconfidentGO:0003674, GO:0005488
GO:0048518 [BP]positive regulation of biological processconfidentGO:0008150, GO:0065007, GO:0050789
GO:0044703 [BP]multi-organism reproductive processconfidentGO:0022414, GO:0008150, GO:0000003
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005635 [CC]nuclear envelopeconfidentGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030425 [CC]dendriteconfidentGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0060255 [BP]regulation of macromolecule metabolic processconfidentGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0006309 [BP]apoptotic DNA fragmentationprobableGO:0006921, GO:0097194, GO:0090304, GO:0090305, GO:0034641, GO:0030262, GO:0007569, GO:0044699, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071840, GO:0016043, GO:0006308, GO:0008150, GO:0071704, GO:1901360, GO:0010259, GO:0009987, GO:0044238, GO:0006915, GO:0006725, GO:0046700, GO:0006259, GO:0044763, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0044248, GO:0044270, GO:0012501, GO:0000737, GO:0044237, GO:0043170, GO:0006807, GO:0019439, GO:0022411
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0019058 [BP]viral infectious cycleprobableGO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0051704
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005643 [CC]nuclear poreprobableGO:0005635, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0031224, GO:0044446, GO:0046930, GO:0016021, GO:0016020, GO:0031967, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044428, GO:0044424, GO:0044425, GO:0005634, GO:0044422
GO:0008139 [MF]nuclear localization sequence bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0005048, GO:0005488
GO:0019221 [BP]cytokine-mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0034097, GO:0008150, GO:0071345, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0071310, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0042221, GO:0007154, GO:0070887, GO:0010033, GO:0044699
GO:0042307 [BP]positive regulation of protein import into nucleusprobableGO:1900180, GO:0070201, GO:0032879, GO:0032388, GO:0060341, GO:0033157, GO:0051049, GO:0032386, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0046824, GO:0065007, GO:0046822, GO:0048518, GO:0042306, GO:0051222, GO:0051223, GO:0050789, GO:0032880
GO:0060135 [BP]maternal process involved in female pregnancyprobableGO:0044703, GO:0044702, GO:0048609, GO:0032504, GO:0044706, GO:0007565, GO:0022414, GO:0032501, GO:0008150, GO:0051704, GO:0044699, GO:0000003
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0000176 [CC]nuclear exosome (RNase complex)probableGO:0043234, GO:0005575, GO:0000178, GO:0032991, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000018 [BP]regulation of DNA recombinationprobableGO:0051052, GO:0019222, GO:0060255, GO:0031323, GO:0050794, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0050789, GO:0080090
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0030674 [MF]protein binding, bridgingprobableGO:0003674, GO:0005488, GO:0005515, GO:0060090
GO:0009411 [BP]response to UVprobableGO:0008150, GO:0009314, GO:0050896, GO:0009416, GO:0009628
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0019048 [BP]virus-host interactionprobableGO:0044419, GO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0044403, GO:0051701, GO:0051704
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0000087 [BP]M phase of mitotic cell cycleprobableGO:0044699, GO:0000279, GO:0000278, GO:0009987, GO:0008150, GO:0044763, GO:0022403, GO:0022402, GO:0007049
GO:0044267 [BP]cellular protein metabolic processprobableGO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0022412 [BP]cellular process involved in reproduction in multicellular organismprobableGO:0032501, GO:0000003, GO:0032504, GO:0009987, GO:0048610, GO:0008150
GO:0040023 [BP]establishment of nucleus localizationprobableGO:0051234, GO:0009987, GO:0008150, GO:0044763, GO:0044699, GO:0051649, GO:0051647, GO:0051656, GO:0051179, GO:0051640, GO:0051641
GO:0003006 [BP]developmental process involved in reproductionprobableGO:0032502, GO:0022414, GO:0008150, GO:0000003
GO:0033554 [BP]cellular response to stressprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0006952 [BP]defense responseprobableGO:0006950, GO:0008150, GO:0050896
GO:0080034 [BP]host response to induction by symbiont of tumor, nodule or growth in hostprobableGO:0009607, GO:0050896, GO:0009608, GO:0008150, GO:0051707, GO:0051704
GO:0030581 [BP]symbiont intracellular protein transport in hostprobableGO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0044419, GO:0071702, GO:0051704, GO:0033036, GO:0006810, GO:0034613, GO:0006858, GO:0045184, GO:0044766, GO:0051708, GO:0008150, GO:0051649, GO:0051701, GO:0051234, GO:0051179, GO:0051641, GO:0046907, GO:0044763, GO:0015031, GO:0044403, GO:0009987
GO:0007292 [BP]female gamete generationprobableGO:0044702, GO:0000003, GO:0032504, GO:0019953, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0048609
GO:0006612 [BP]protein targeting to membraneprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006886, GO:0006810, GO:0006605, GO:0045184, GO:0044765, GO:0008104, GO:0008150, GO:0071702, GO:0015031, GO:0044763, GO:0009987, GO:0051234, GO:0051649, GO:0051179, GO:0044699, GO:0051641
GO:0046015 [BP]regulation of transcription by glucoseprobableGO:0009991, GO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0070887, GO:0042221, GO:0050789, GO:0044699, GO:0051716, GO:0031670, GO:2000112, GO:0060255, GO:0065007, GO:0010468, GO:0071496, GO:0019219, GO:0007584, GO:0009987, GO:0009889, GO:0050794, GO:0045990, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0031668, GO:0031669, GO:0009605, GO:0050896, GO:0051252, GO:0031667, GO:0006355, GO:0010556, GO:0008150
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0030261 [BP]chromosome condensationprobableGO:0071103, GO:0090304, GO:0034641, GO:0006807, GO:0016043, GO:0071840, GO:0006139, GO:0044260, GO:0006323, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0044699, GO:0051276, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0007346 [BP]regulation of mitotic cell cycleprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0051726

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JDQ, chain A
Confidence level:very confident
Coverage over the Query: 2-333
View the alignment between query and template
View the model in PyMOL
Template: 3TPO, chain A
Confidence level:very confident
Coverage over the Query: 1-330
View the alignment between query and template
View the model in PyMOL