Psyllid ID: psy664


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MQTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMSLDNNILYPLIDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDASGAQEFTFAGATQGGACDSTTMLAGGGGGFNF
cHHHHHHHcccHHHHHHHccccccHHHHcHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHHHccccccccHHHHHccHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHcccccHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHccHHHHHHHHcccccccHcccHHHHHHHHHcccHHHHHHHccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcHHHHcccHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccccccccccccEEEccccccccccccccccccccccccc
mqtrmvidagAVPVFIQLLlsphedqvthpsvetmsldnnilyplidkpknrlsmVRNSVWVLSnlcrgktpppdfakvaPALACLSRLLFHADPDVLADACWAisylsdgpnekiQAVIDAGVCRRLVELLMHDQHKVVSAALRAVgnivtgddqqtQVILNCSALMCLLHLIQSPKESIRKEACWAvsnitagnrQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAItnatsggtpDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEakqtgsvnpYVVLIEECygldkieflQSHENIEIYQKAFDIIEhyfgseeedtrvapcvthdasgaqeftfagatqggacdsttmlagggggfnf
mqtrmvidagaVPVFIQLLLSPHEDQVTHPsvetmsldnNILYPLIDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAItnatsggtpdQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEeakqtgsvnPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDASGAQEFTFAGATQGGACDSTTMLAGGGGGFNF
MQTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMSLDNNILYPLIDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDASGAQEFTFAGATQGGACDSTTMLAGGGGGFNF
*****VIDAGAVPVFIQLLLSPHEDQVTHPSVETMSLDNNILYPLIDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDASGAQEFTFA***********************
MQTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMSLDNNILYPLIDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDASGAQEFTFAGA*******************N*
MQTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMSLDNNILYPLIDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDASGAQEFTFAGATQGGACDSTTMLAGGGGGFNF
MQTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMSLDNNILYPLIDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDAS*****T*************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMSLDNNILYPLIDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDASGAQEFTFAGATQGGACDSTTMLAGGGGGFNF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query379 2.2.26 [Sep-21-2011]
Q5RBV0536 Importin subunit alpha-7 yes N/A 0.923 0.652 0.702 1e-147
O60684536 Importin subunit alpha-7 yes N/A 0.923 0.652 0.702 1e-147
O35345536 Importin subunit alpha-7 yes N/A 0.923 0.652 0.7 1e-146
Q0V7M0536 Importin subunit alpha-7 yes N/A 0.923 0.652 0.7 1e-146
O15131536 Importin subunit alpha-6 no N/A 0.912 0.645 0.695 1e-144
Q503E9536 Importin subunit alpha-6 no N/A 0.905 0.639 0.7 1e-143
Q56R16536 Importin subunit alpha-6 no N/A 0.905 0.639 0.678 1e-140
P83953538 Importin subunit alpha-1 no N/A 0.902 0.635 0.710 1e-140
A2VE08538 Importin subunit alpha-1 no N/A 0.902 0.635 0.707 1e-140
P52294538 Importin subunit alpha-1 no N/A 0.902 0.635 0.707 1e-139
>sp|Q5RBV0|IMA7_PONAB Importin subunit alpha-7 OS=Pongo abelii GN=KPNA6 PE=2 SV=1 Back     alignment and function desciption
 Score =  521 bits (1342), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 260/370 (70%), Positives = 301/370 (81%), Gaps = 20/370 (5%)

Query: 2   QTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMS-------------LDNNILYPLID- 47
           QT++VI+AGAVP+FI+LL S  ED V   +V  +              L+ +IL PL+  
Sbjct: 159 QTKIVIEAGAVPIFIELLNSDFED-VQEQAVWALGNIAGDSSVCRDYVLNCSILNPLLTL 217

Query: 48  -KPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAIS 106
                RL+M RN+VW LSNLCRGK PPP+FAKV+P L  LSRLLF +D D+LADACWA+S
Sbjct: 218 LTKSTRLTMTRNAVWALSNLCRGKNPPPEFAKVSPCLPVLSRLLFSSDSDLLADACWALS 277

Query: 107 YLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSA 166
           YLSDGPNEKIQAVID+GVCRRLVELLMH+ +KV S ALRAVGNIVTGDD QTQVILNCSA
Sbjct: 278 YLSDGPNEKIQAVIDSGVCRRLVELLMHNDYKVASPALRAVGNIVTGDDIQTQVILNCSA 337

Query: 167 LMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKE 226
           L CLLHL+ SPKESIRKEACW +SNITAGNR QIQAVIDANIFP LIEILQKAEF+TRKE
Sbjct: 338 LPCLLHLLSSPKESIRKEACWTISNITAGNRAQIQAVIDANIFPVLIEILQKAEFRTRKE 397

Query: 227 AAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAK 286
           AAWAITNATSGGTP+QIRYL+  GCI+P C+LLT++D+KI+QVALNGLENIL+LGE+E K
Sbjct: 398 AAWAITNATSGGTPEQIRYLVSLGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEGK 457

Query: 287 QTGS-VNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTH 345
           ++GS VNPY  LIEE YGLDKIEFLQSHEN EIYQKAFD+IEHYFG E++D+ +AP V  
Sbjct: 458 RSGSGVNPYCGLIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGVEDDDSSLAPQVDE 517

Query: 346 DASGAQEFTF 355
                Q+F F
Sbjct: 518 ---TQQQFIF 524




Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.
Pongo abelii (taxid: 9601)
>sp|O60684|IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens GN=KPNA6 PE=1 SV=1 Back     alignment and function description
>sp|O35345|IMA7_MOUSE Importin subunit alpha-7 OS=Mus musculus GN=Kpna6 PE=1 SV=2 Back     alignment and function description
>sp|Q0V7M0|IMA7_BOVIN Importin subunit alpha-7 OS=Bos taurus GN=KPNA6 PE=2 SV=1 Back     alignment and function description
>sp|O15131|IMA5_HUMAN Importin subunit alpha-6 OS=Homo sapiens GN=KPNA5 PE=1 SV=2 Back     alignment and function description
>sp|Q503E9|IMA5_DANRE Importin subunit alpha-6 OS=Danio rerio GN=kpna5 PE=2 SV=2 Back     alignment and function description
>sp|Q56R16|IMA5_RAT Importin subunit alpha-6 OS=Rattus norvegicus GN=Kpna5 PE=2 SV=1 Back     alignment and function description
>sp|P83953|IMA1_RAT Importin subunit alpha-1 OS=Rattus norvegicus GN=Kpna1 PE=2 SV=1 Back     alignment and function description
>sp|A2VE08|IMA1_BOVIN Importin subunit alpha-1 OS=Bos taurus GN=KPNA1 PE=2 SV=1 Back     alignment and function description
>sp|P52294|IMA1_HUMAN Importin subunit alpha-1 OS=Homo sapiens GN=KPNA1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
91077058 526 PREDICTED: similar to karyopherin alpha 0.960 0.692 0.696 1e-153
260790515 527 hypothetical protein BRAFLDRAFT_279360 [ 0.926 0.666 0.717 1e-148
345320450 559 PREDICTED: importin subunit alpha-6 [Orn 0.910 0.617 0.715 1e-146
307177535 670 Importin subunit alpha-7 [Camponotus flo 0.931 0.526 0.710 1e-146
296207336 566 PREDICTED: importin subunit alpha-7 isof 0.931 0.623 0.699 1e-146
291408903 541 PREDICTED: karyopherin alpha 6-like [Ory 0.923 0.646 0.705 1e-146
395534831 560 PREDICTED: importin subunit alpha-6 [Sar 0.910 0.616 0.712 1e-145
449497781 539 PREDICTED: importin subunit alpha-6 isof 0.902 0.634 0.718 1e-145
395857909476 PREDICTED: importin subunit alpha-7 [Oto 0.923 0.735 0.705 1e-145
449277980 539 Importin subunit alpha-6, partial [Colum 0.902 0.634 0.718 1e-145
>gi|91077058|ref|XP_968505.1| PREDICTED: similar to karyopherin alpha 6 [Tribolium castaneum] gi|270002024|gb|EEZ98471.1| hypothetical protein TcasGA2_TC000963 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 273/392 (69%), Positives = 307/392 (78%), Gaps = 28/392 (7%)

Query: 2   QTRMVIDAGAVPVFIQLLLSPHEDQVTH------------PSVETMSLDNNILYPLID-- 47
           QTRMVI+AGAVP+FI+LL S +ED                P      LD+ IL PL+   
Sbjct: 149 QTRMVIEAGAVPIFIRLLSSQYEDVQEQAVWALGNIAGDSPECRDHVLDSGILVPLLQLL 208

Query: 48  KPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISY 107
               RLSM RN+VW LSNLCRGK PPPDFAKV+PAL  L+RLLFH+DPDVL+D CWA+SY
Sbjct: 209 SKSTRLSMTRNAVWALSNLCRGKNPPPDFAKVSPALPVLARLLFHSDPDVLSDTCWALSY 268

Query: 108 LSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSAL 167
           LSDGPNEKIQAVIDAGVCR+LVELLMH Q  VVSAALRAVGNIVTGDD QTQVILNCSAL
Sbjct: 269 LSDGPNEKIQAVIDAGVCRKLVELLMHQQPNVVSAALRAVGNIVTGDDVQTQVILNCSAL 328

Query: 168 MCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEA 227
            CL HL+ S KES+RKEACW +SNITAGNRQQIQAVIDANIFP LIEIL KAEFKTRKEA
Sbjct: 329 HCLHHLLSSSKESVRKEACWTISNITAGNRQQIQAVIDANIFPVLIEILSKAEFKTRKEA 388

Query: 228 AWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQ 287
           AWAITNATSGGTPDQIRYL+ Q CI P C+LLT++DAKI+QVALNGLENIL+LGE++AK 
Sbjct: 389 AWAITNATSGGTPDQIRYLVNQACIGPLCDLLTVMDAKIVQVALNGLENILRLGEQDAKN 448

Query: 288 TGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTHDA 347
               NPY VLIE+CYGLDKIEFLQSH N+EIYQKAFDIIEH+FG+EEEDT VAP V  D 
Sbjct: 449 HSGTNPYAVLIEQCYGLDKIEFLQSHVNMEIYQKAFDIIEHFFGTEEEDTTVAPSVNPD- 507

Query: 348 SGAQEFTFAGATQGGACDSTTMLAGGGGGFNF 379
              Q++ F+        D +  +    GGF+F
Sbjct: 508 --QQQYHFSS-------DQSVPM----GGFHF 526




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|260790515|ref|XP_002590287.1| hypothetical protein BRAFLDRAFT_279360 [Branchiostoma floridae] gi|229275479|gb|EEN46298.1| hypothetical protein BRAFLDRAFT_279360 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|345320450|ref|XP_001518163.2| PREDICTED: importin subunit alpha-6 [Ornithorhynchus anatinus] Back     alignment and taxonomy information
>gi|307177535|gb|EFN66646.1| Importin subunit alpha-7 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|296207336|ref|XP_002750602.1| PREDICTED: importin subunit alpha-7 isoform 1 [Callithrix jacchus] Back     alignment and taxonomy information
>gi|291408903|ref|XP_002720679.1| PREDICTED: karyopherin alpha 6-like [Oryctolagus cuniculus] Back     alignment and taxonomy information
>gi|395534831|ref|XP_003769440.1| PREDICTED: importin subunit alpha-6 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|449497781|ref|XP_004174270.1| PREDICTED: importin subunit alpha-6 isoform 2 [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|395857909|ref|XP_003801323.1| PREDICTED: importin subunit alpha-7 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|449277980|gb|EMC85980.1| Importin subunit alpha-6, partial [Columba livia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
UNIPROTKB|E1C4J0539 KPNA5 "Importin subunit alpha" 0.928 0.653 0.708 1.1e-133
UNIPROTKB|J9NTP2539 KPNA5 "Importin subunit alpha" 0.928 0.653 0.702 7.9e-133
UNIPROTKB|O15131536 KPNA5 "Importin subunit alpha- 0.928 0.656 0.697 1.6e-132
UNIPROTKB|F1PM77536 KPNA6 "Importin subunit alpha" 0.923 0.652 0.705 1.2e-131
UNIPROTKB|F5GYL8541 KPNA6 "Importin subunit alpha" 0.923 0.646 0.705 1.2e-131
UNIPROTKB|F5H4G7533 KPNA6 "Importin subunit alpha" 0.923 0.656 0.705 1.2e-131
UNIPROTKB|O60684536 KPNA6 "Importin subunit alpha- 0.923 0.652 0.705 1.2e-131
RGD|735064538 Kpna1 "karyopherin alpha 1" [R 0.926 0.652 0.703 1.5e-131
UNIPROTKB|Q56R20538 Kpna1 "Importin subunit alpha" 0.926 0.652 0.703 1.5e-131
UNIPROTKB|A2VE08538 KPNA1 "Importin subunit alpha- 0.926 0.652 0.700 2.4e-131
UNIPROTKB|E1C4J0 KPNA5 "Importin subunit alpha" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 1310 (466.2 bits), Expect = 1.1e-133, P = 1.1e-133
 Identities = 262/370 (70%), Positives = 301/370 (81%)

Query:     1 MQTRMVIDAGAVPVFIQLLLSPHED----------QVTHPSVETMS--LDNNILYPLID- 47
             + T++VI+ GAVP+FI+LL S HED           +   + E     L+  IL PL++ 
Sbjct:   161 LHTKVVIETGAVPIFIKLLSSEHEDVQEQAVWALGNIAGDNAECRDFVLNCGILPPLLEL 220

Query:    48 -KPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAIS 106
                 NRL+  RN+VW LSNLCRGK PPPDF+KVAP L  LSRLLF +DPDVLADACWA+S
Sbjct:   221 LTNSNRLTTTRNAVWALSNLCRGKNPPPDFSKVAPCLNVLSRLLFSSDPDVLADACWALS 280

Query:   107 YLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSA 166
             YLSDGPN+KIQAVID+GVCRRLVELLMH+ +KVVS ALRAVGNIVTGDD QTQVILNCSA
Sbjct:   281 YLSDGPNDKIQAVIDSGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSA 340

Query:   167 LMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKE 226
             L CLLHL+ SPKESIRKEACW VSNITAGNR QIQAVIDANIFP LIEILQKAEF+TRKE
Sbjct:   341 LPCLLHLLSSPKESIRKEACWTVSNITAGNRAQIQAVIDANIFPILIEILQKAEFRTRKE 400

Query:   227 AAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAK 286
             AAWAITNATSGGTP+QIRYL+  GC +P C+LLT++D+KI+QVALNGLENIL+LGE+E+K
Sbjct:   401 AAWAITNATSGGTPEQIRYLVALGCTKPLCDLLTVMDSKIVQVALNGLENILRLGEQESK 460

Query:   287 QTG-SVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPCVTH 345
             Q G  +NPY  LIEE YGLDKIEFLQ HEN EIYQKAF++IEHYFG EEED+ +AP V  
Sbjct:   461 QNGMGINPYCALIEEAYGLDKIEFLQRHENQEIYQKAFELIEHYFGVEEEDSSIAPQV-- 518

Query:   346 DASGAQEFTF 355
             D S  Q+F F
Sbjct:   519 DES-QQQFVF 527


GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006606 "protein import into nucleus" evidence=IEA
GO:0008565 "protein transporter activity" evidence=IEA
UNIPROTKB|J9NTP2 KPNA5 "Importin subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O15131 KPNA5 "Importin subunit alpha-6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PM77 KPNA6 "Importin subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F5GYL8 KPNA6 "Importin subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H4G7 KPNA6 "Importin subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O60684 KPNA6 "Importin subunit alpha-7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|735064 Kpna1 "karyopherin alpha 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q56R20 Kpna1 "Importin subunit alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A2VE08 KPNA1 "Importin subunit alpha-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P52294IMA1_HUMANNo assigned EC number0.70750.90230.6356noN/A
Q60960IMA1_MOUSENo assigned EC number0.70750.90230.6356noN/A
O35345IMA7_MOUSENo assigned EC number0.70.92340.6529yesN/A
Q19969IMA3_CAEELNo assigned EC number0.45400.94190.6945yesN/A
P83953IMA1_RATNo assigned EC number0.71030.90230.6356noN/A
Q5R909IMA1_PONABNo assigned EC number0.70750.90230.6356noN/A
A2VE08IMA1_BOVINNo assigned EC number0.70750.90230.6356noN/A
Q5RBV0IMA7_PONABNo assigned EC number0.70270.92340.6529yesN/A
Q02821IMA1_YEASTNo assigned EC number0.49860.93400.6531yesN/A
Q96321IMA1_ARATHNo assigned EC number0.50750.96040.6842yesN/A
O94374IMA2_SCHPONo assigned EC number0.49730.93660.6586yesN/A
Q76P29IMAB_DICDINo assigned EC number0.53400.87590.6434yesN/A
O60684IMA7_HUMANNo assigned EC number0.70270.92340.6529yesN/A
Q0V7M0IMA7_BOVINNo assigned EC number0.70.92340.6529yesN/A
Q9SLX0IMA1B_ORYSJNo assigned EC number0.54850.87860.6235yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
COG5064526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 1e-144
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 3e-29
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 4e-27
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 9e-23
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 4e-19
COG5064 526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 1e-15
COG5064 526 COG5064, SRP1, Karyopherin (importin) alpha [Intra 7e-15
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 1e-07
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 8e-07
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 9e-07
cd00020120 cd00020, ARM, Armadillo/beta-catenin-like repeats 2e-06
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 3e-06
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 5e-06
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 9e-06
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 8e-05
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 4e-04
pfam0051441 pfam00514, Arm, Armadillo/beta-catenin-like repeat 5e-04
smart0018541 smart00185, ARM, Armadillo/beta-catenin-like repea 7e-04
pfam1351355 pfam13513, HEAT_EZ, HEAT-like repeat 0.002
pfam1351355 pfam13513, HEAT_EZ, HEAT-like repeat 0.003
pfam1364688 pfam13646, HEAT_2, HEAT repeats 0.003
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
 Score =  418 bits (1077), Expect = e-144
 Identities = 197/378 (52%), Positives = 253/378 (66%), Gaps = 25/378 (6%)

Query: 2   QTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMS-------------LDNNILYP---L 45
           QT++V+DAGAVP+FIQLL S  ED V   +V  +              L    L P   L
Sbjct: 149 QTKVVVDAGAVPLFIQLLSST-EDDVREQAVWALGNIAGDSEGCRDYVLQCGALEPLLGL 207

Query: 46  IDKPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAI 105
           +      +SM+RN+ W LSNLCRGK PPPD++ ++ AL  L++L++  DP+VL DACWAI
Sbjct: 208 LLSSAIHISMLRNATWTLSNLCRGKNPPPDWSNISQALPILAKLIYSRDPEVLVDACWAI 267

Query: 106 SYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCS 165
           SYLSDGPNEKIQAV+D G+  RLVELL H+  K+ + ALR+VGNIVTG D QTQVI+NC 
Sbjct: 268 SYLSDGPNEKIQAVLDVGIPGRLVELLSHESAKIQTPALRSVGNIVTGSDDQTQVIINCG 327

Query: 166 ALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRK 225
           AL     L+ SPKE+IRKEACW +SNITAGN +QIQAVIDAN+ P LI +L  AE+K +K
Sbjct: 328 ALKAFRSLLSSPKENIRKEACWTISNITAGNTEQIQAVIDANLIPPLIHLLSSAEYKIKK 387

Query: 226 EAAWAITNATSGGT--PDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGE- 282
           EA WAI+NATSGG   PD IRYL+ QG I+P C+LL ++D KII+VAL+ +ENILK+GE 
Sbjct: 388 EACWAISNATSGGLNRPDIIRYLVSQGFIKPLCDLLDVVDNKIIEVALDAIENILKVGEQ 447

Query: 283 EEAKQTGSVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAPC 342
           +  +   ++N Y V +E+  G+D I  LQ   N  IY KA+ IIE +FG E+    +AP 
Sbjct: 448 DRLRYGKNINIYAVYVEKAGGMDAIHGLQDSVNRTIYDKAYSIIEKFFGEEDAVDELAPE 507

Query: 343 VTHDASGAQEFTFAGATQ 360
              +      FTF     
Sbjct: 508 TAGNT-----FTFGSNVN 520


Length = 526

>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|227396 COG5064, SRP1, Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|237987 cd00020, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|201276 pfam00514, Arm, Armadillo/beta-catenin-like repeat Back     alignment and domain information
>gnl|CDD|214547 smart00185, ARM, Armadillo/beta-catenin-like repeats Back     alignment and domain information
>gnl|CDD|205691 pfam13513, HEAT_EZ, HEAT-like repeat Back     alignment and domain information
>gnl|CDD|205691 pfam13513, HEAT_EZ, HEAT-like repeat Back     alignment and domain information
>gnl|CDD|222285 pfam13646, HEAT_2, HEAT repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 379
KOG0166|consensus514 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
KOG0166|consensus514 100.0
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 100.0
KOG4224|consensus550 99.96
KOG4224|consensus550 99.95
PF05804708 KAP: Kinesin-associated protein (KAP) 99.9
PF05804708 KAP: Kinesin-associated protein (KAP) 99.81
KOG1048|consensus717 99.73
KOG4199|consensus461 99.72
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.71
KOG1222|consensus791 99.7
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.67
KOG4199|consensus461 99.66
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.66
KOG2122|consensus 2195 99.63
PRK09687280 putative lyase; Provisional 99.61
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.6
KOG1048|consensus717 99.58
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 99.56
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 99.55
KOG2122|consensus 2195 99.51
PRK09687280 putative lyase; Provisional 99.5
KOG1293|consensus678 99.5
KOG4500|consensus 604 99.47
KOG1222|consensus791 99.44
KOG4500|consensus604 99.4
KOG2171|consensus 1075 99.35
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.35
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.32
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.3
KOG2160|consensus342 99.28
KOG0168|consensus 1051 99.28
KOG0168|consensus 1051 99.24
KOG2171|consensus 1075 99.23
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.21
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.18
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 99.13
KOG2160|consensus342 99.08
KOG2759|consensus442 99.08
KOG1293|consensus678 99.05
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.05
KOG2023|consensus 885 99.03
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 99.02
KOG2759|consensus442 98.92
KOG3678|consensus 832 98.88
PTZ00429 746 beta-adaptin; Provisional 98.88
PTZ00429 746 beta-adaptin; Provisional 98.86
KOG2023|consensus 885 98.84
KOG0946|consensus 970 98.81
KOG1241|consensus 859 98.8
KOG0946|consensus 970 98.76
KOG1241|consensus 859 98.71
KOG1517|consensus 1387 98.66
COG5369743 Uncharacterized conserved protein [Function unknow 98.61
KOG2973|consensus353 98.56
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.56
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.55
KOG1517|consensus 1387 98.53
KOG3678|consensus 832 98.53
KOG1059|consensus 877 98.46
KOG0213|consensus1172 98.45
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.42
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 98.4
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 98.39
KOG4413|consensus 524 98.36
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.35
TIGR02270410 conserved hypothetical protein. Members are found 98.32
KOG2734|consensus536 98.31
KOG1242|consensus 569 98.29
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 98.25
KOG1062|consensus 866 98.24
COG5369743 Uncharacterized conserved protein [Function unknow 98.24
KOG1059|consensus 877 98.23
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.18
KOG4413|consensus 524 98.18
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.17
TIGR02270410 conserved hypothetical protein. Members are found 98.16
KOG1062|consensus 866 98.15
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 98.15
KOG1242|consensus569 98.12
KOG2259|consensus 823 98.12
KOG0213|consensus 1172 98.12
PF05536 543 Neurochondrin: Neurochondrin 98.11
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 98.11
KOG1824|consensus 1233 98.09
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 98.09
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.05
COG5231432 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Ene 98.04
KOG4646|consensus173 98.02
COG1413335 FOG: HEAT repeat [Energy production and conversion 98.0
KOG1240|consensus 1431 97.98
KOG1824|consensus 1233 97.98
KOG0212|consensus 675 97.98
PF05536 543 Neurochondrin: Neurochondrin 97.97
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.97
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.97
KOG0212|consensus 675 97.94
KOG1061|consensus 734 97.92
KOG4646|consensus173 97.91
KOG1077|consensus 938 97.88
KOG1077|consensus 938 97.85
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 97.82
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 97.77
KOG2973|consensus353 97.76
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.75
KOG1789|consensus2235 97.74
KOG1789|consensus2235 97.72
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.71
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.7
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 97.69
KOG1061|consensus 734 97.67
KOG4151|consensus748 97.64
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.64
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.63
smart0018541 ARM Armadillo/beta-catenin-like repeats. Approx. 4 97.61
KOG1991|consensus 1010 97.6
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.59
KOG4535|consensus728 97.58
KOG0915|consensus 1702 97.58
KOG2734|consensus 536 97.55
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 97.55
PF09759102 Atx10homo_assoc: Spinocerebellar ataxia type 10 pr 97.54
KOG2259|consensus 823 97.52
KOG1060|consensus 968 97.51
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.47
KOG0211|consensus759 97.46
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.43
PF10165446 Ric8: Guanine nucleotide exchange factor synembryn 97.41
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 97.33
PF11841160 DUF3361: Domain of unknown function (DUF3361) 97.33
KOG4535|consensus728 97.32
KOG3036|consensus293 97.3
KOG1240|consensus 1431 97.3
KOG0567|consensus289 97.28
KOG0915|consensus 1702 97.25
KOG1058|consensus 948 97.21
KOG0211|consensus759 97.19
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 97.17
KOG1943|consensus 1133 97.13
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.12
KOG1058|consensus 948 97.11
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.09
KOG0567|consensus289 97.09
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 97.03
KOG1060|consensus 968 97.03
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 97.03
KOG1991|consensus 1010 97.03
PF05004309 IFRD: Interferon-related developmental regulator ( 97.0
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 97.0
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 96.98
KOG2274|consensus 1005 96.94
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 96.94
KOG1967|consensus1030 96.94
KOG4151|consensus748 96.88
KOG1248|consensus 1176 96.87
PF08045257 CDC14: Cell division control protein 14, SIN compo 96.86
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 96.85
KOG2062|consensus 929 96.81
KOG2274|consensus 1005 96.77
PF05004309 IFRD: Interferon-related developmental regulator ( 96.76
KOG1248|consensus 1176 96.74
PF06025379 DUF913: Domain of Unknown Function (DUF913); Inter 96.74
KOG0414|consensus1251 96.68
KOG1967|consensus1030 96.65
KOG1943|consensus 1133 96.63
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.61
KOG2025|consensus 892 96.56
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 96.51
COG5656 970 SXM1 Importin, protein involved in nuclear import 96.51
KOG1020|consensus 1692 96.5
KOG1243|consensus690 96.49
KOG3036|consensus293 96.48
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.39
KOG1020|consensus 1692 96.34
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.33
KOG2032|consensus533 96.32
KOG2062|consensus 929 96.32
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 96.3
PF11701157 UNC45-central: Myosin-binding striated muscle asse 96.25
KOG1243|consensus 690 96.23
KOG1078|consensus 865 96.2
PF1466873 RICTOR_V: Rapamycin-insensitive companion of mTOR, 96.19
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 96.14
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 96.13
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 96.1
COG5656 970 SXM1 Importin, protein involved in nuclear import 96.09
KOG4653|consensus982 96.04
KOG4653|consensus982 96.02
PF13764 802 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 95.99
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 95.9
KOG2032|consensus533 95.88
PF11701157 UNC45-central: Myosin-binding striated muscle asse 95.82
KOG2956|consensus516 95.79
KOG0414|consensus1251 95.78
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 95.74
KOG2137|consensus700 95.7
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 95.63
KOG2025|consensus 892 95.62
COG5116 926 RPN2 26S proteasome regulatory complex component [ 95.61
PF08045257 CDC14: Cell division control protein 14, SIN compo 95.55
KOG1078|consensus 865 95.53
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 95.53
PF07814361 WAPL: Wings apart-like protein regulation of heter 95.47
COG50981128 Chromosome condensation complex Condensin, subunit 95.45
KOG1820|consensus 815 95.34
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 95.33
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 95.13
KOG2933|consensus334 95.09
PF04063192 DUF383: Domain of unknown function (DUF383); Inter 95.06
COG5116 926 RPN2 26S proteasome regulatory complex component [ 95.05
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 94.95
KOG1949|consensus 1005 94.89
KOG2999|consensus 713 94.55
PF13251182 DUF4042: Domain of unknown function (DUF4042) 94.52
KOG2137|consensus 700 94.48
KOG3665|consensus699 94.44
KOG1820|consensus 815 94.43
KOG1566|consensus342 94.41
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 94.33
KOG2956|consensus516 94.31
PF1036392 DUF2435: Protein of unknown function (DUF2435) 94.26
COG50981128 Chromosome condensation complex Condensin, subunit 94.24
smart00638574 LPD_N Lipoprotein N-terminal Domain. 94.18
KOG1848|consensus 1610 94.16
KOG2999|consensus 713 94.1
KOG3665|consensus699 94.02
KOG1566|consensus342 93.98
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 93.84
PF06685249 DUF1186: Protein of unknown function (DUF1186); In 93.8
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 93.62
COG5209315 RCD1 Uncharacterized protein involved in cell diff 93.6
PF08167165 RIX1: rRNA processing/ribosome biogenesis 93.52
cd03572122 ENTH_epsin_related ENTH domain, Epsin Related fami 92.99
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 92.96
PF06371187 Drf_GBD: Diaphanous GTPase-binding Domain; InterPr 92.91
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 92.77
PF1036392 DUF2435: Protein of unknown function (DUF2435) 92.51
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 92.45
PF13251182 DUF4042: Domain of unknown function (DUF4042) 92.27
KOG2933|consensus334 92.1
PRK14707 2710 hypothetical protein; Provisional 92.06
PRK14707 2710 hypothetical protein; Provisional 92.05
cd03561133 VHS VHS domain family; The VHS domain is present i 91.84
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 91.8
KOG2611|consensus 698 91.3
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 91.25
PF07814361 WAPL: Wings apart-like protein regulation of heter 91.08
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 90.85
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 90.72
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 90.68
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 90.61
PF08167165 RIX1: rRNA processing/ribosome biogenesis 90.41
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 90.18
KOG0413|consensus 1529 90.11
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 90.06
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 89.37
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 89.37
COG5209315 RCD1 Uncharacterized protein involved in cell diff 88.89
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 88.74
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 88.38
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 88.32
KOG4464|consensus 532 88.02
PF1472698 RTTN_N: Rotatin, an armadillo repeat protein, cent 87.6
PF14225262 MOR2-PAG1_C: Cell morphogenesis C-terminal 87.57
PF11864464 DUF3384: Domain of unknown function (DUF3384); Int 87.47
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 86.68
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 86.46
cd03565141 VHS_Tom1 VHS domain family, Tom1 subfamily; The VH 86.43
PF06685249 DUF1186: Protein of unknown function (DUF1186); In 86.41
PF08324268 PUL: PUL domain; InterPro: IPR013535 The PUL (afte 86.33
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 85.74
KOG0301|consensus745 85.28
cd00197115 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil 84.73
PF12463303 DUF3689: Protein of unknown function (DUF3689) ; I 84.73
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 84.52
KOG0392|consensus 1549 84.31
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 84.21
KOG0803|consensus 1312 84.1
PF14500262 MMS19_N: Dos2-interacting transcription regulator 84.02
cd03561133 VHS VHS domain family; The VHS domain is present i 83.4
smart00638574 LPD_N Lipoprotein N-terminal Domain. 83.1
KOG1949|consensus 1005 83.01
KOG1525|consensus 1266 82.71
KOG4464|consensus 532 82.29
PF12031257 DUF3518: Domain of unknown function (DUF3518); Int 81.78
KOG2038|consensus 988 81.65
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 81.19
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 81.05
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 80.73
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 80.59
PF04821266 TIMELESS: Timeless protein; InterPro: IPR006906 Th 80.15
>KOG0166|consensus Back     alignment and domain information
Probab=100.00  E-value=1.5e-66  Score=475.56  Aligned_cols=339  Identities=61%  Similarity=0.964  Sum_probs=322.6

Q ss_pred             ChhhhhhhCCChHHHHhhcCCCCCCccc------------CchhHHHHHhCCChHHHHhcC--CCChhHHHHHHHHHHHH
Q psy664            1 MQTRMVIDAGAVPVFIQLLLSPHEDQVT------------HPSVETMSLDNNILYPLIDKP--KNRLSMVRNSVWVLSNL   66 (379)
Q Consensus         1 ~~~~~~~~~g~i~~L~~lL~s~~~~v~~------------~~~~r~~i~~~g~i~~Ll~lL--~~~~~~~~~a~~~L~~l   66 (379)
                      |||+.++++|++|.|++||.|++.++++            ++.+|+.+++.|++++|+.++  +....+.|+++|+|+||
T Consensus       143 e~T~~vv~agavp~fi~Ll~s~~~~v~eQavWALgNIagds~~~Rd~vl~~g~l~pLl~~l~~~~~~~~lRn~tW~LsNl  222 (514)
T KOG0166|consen  143 EQTKVVVDAGAVPIFIQLLSSPSADVREQAVWALGNIAGDSPDCRDYVLSCGALDPLLRLLNKSDKLSMLRNATWTLSNL  222 (514)
T ss_pred             hhccccccCCchHHHHHHhcCCcHHHHHHHHHHHhccccCChHHHHHHHhhcchHHHHHHhccccchHHHHHHHHHHHHH
Confidence            6899999999999999999999999988            899999999999999999999  33458999999999999


Q ss_pred             hCCCCCCCChHhHhhhHHHHHHhhcCCChHHHHHHHHHHHHhcCCChHHHHHHHhcCcHHHHHHhhcCCChHHHHHHHHH
Q psy664           67 CRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRA  146 (379)
Q Consensus        67 ~~~~~~~~~~~~~~~~l~~L~~lL~~~d~~v~~~a~~aL~~l~~~~~~~~~~~~~~g~i~~L~~lL~~~~~~i~~~al~~  146 (379)
                      |++++|.+.+.....++|.|..++++.|+++..+|||+++||++++++.++.+++.|++++|+.+|.+.+..++.+|+++
T Consensus       223 crgk~P~P~~~~v~~iLp~L~~ll~~~D~~Vl~Da~WAlsyLsdg~ne~iq~vi~~gvv~~LV~lL~~~~~~v~~PaLRa  302 (514)
T KOG0166|consen  223 CRGKNPSPPFDVVAPILPALLRLLHSTDEEVLTDACWALSYLTDGSNEKIQMVIDAGVVPRLVDLLGHSSPKVVTPALRA  302 (514)
T ss_pred             HcCCCCCCcHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHhcCChHHHHHHHHccchHHHHHHHcCCCcccccHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhcCCchhhHHHhhcCcHHHHHHhhc-CCChhhHHHHHHHHHHhhcCChHHHHHHHhcCchHHHHHHHHhCcHHHHH
Q psy664          147 VGNIVTGDDQQTQVILNCSALMCLLHLIQ-SPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRK  225 (379)
Q Consensus       147 L~nl~~~~~~~~~~~~~~~~l~~L~~lL~-~~~~~v~~~a~~~l~nl~~~~~~~~~~~~~~~~i~~Li~ll~~~~~~v~~  225 (379)
                      +|||++|++.+++.+++.|++|.|..++. ++...++++|||+++||++|++++++++++.|++|.|+++|+++++++|+
T Consensus       303 iGNIvtG~d~QTq~vi~~~~L~~l~~ll~~s~~~~ikkEAcW~iSNItAG~~~qiqaVida~l~p~Li~~l~~~ef~~rK  382 (514)
T KOG0166|consen  303 IGNIVTGSDEQTQVVINSGALPVLSNLLSSSPKESIKKEACWTISNITAGNQEQIQAVIDANLIPVLINLLQTAEFDIRK  382 (514)
T ss_pred             ccceeeccHHHHHHHHhcChHHHHHHHhccCcchhHHHHHHHHHHHhhcCCHHHHHHHHHcccHHHHHHHHhccchHHHH
Confidence            99999999999999999999999999998 55677999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhcCCCHHHHHHHHHcCChHHHHHhhccCCHHHHHHHHHHHHHHHHHcHHhhhhcCCcchHHHHHHHhccHH
Q psy664          226 EAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECYGLD  305 (379)
Q Consensus       226 ~a~~~l~nl~~~~~~~~~~~l~~~~~i~~L~~lL~~~d~~v~~~al~~L~~l~~~~~~~~~~~~~~~~~~~~i~~~g~l~  305 (379)
                      +|+|+|+|+++.++++++.+|++.|++++|+++|...|.+++..++.+|.+|+..++.....++  ++++.+|+++||++
T Consensus       383 EAawaIsN~ts~g~~~qi~yLv~~giI~plcdlL~~~D~~ii~v~Ld~l~nil~~~e~~~~~~~--n~~~~~IEe~ggld  460 (514)
T KOG0166|consen  383 EAAWAISNLTSSGTPEQIKYLVEQGIIKPLCDLLTCPDVKIILVALDGLENILKVGEAEKNRGT--NPLAIMIEEAGGLD  460 (514)
T ss_pred             HHHHHHHhhcccCCHHHHHHHHHcCCchhhhhcccCCChHHHHHHHHHHHHHHHHHHHhccccc--cHHHHHHHHccChh
Confidence            9999999999999999999999999999999999999999999999999999999988753221  89999999999999


Q ss_pred             HHHHhhcCCCHHHHHHHHHHHHHhcCCCcccccCCC
Q psy664          306 KIEFLQSHENIEIYQKAFDIIEHYFGSEEEDTRVAP  341 (379)
Q Consensus       306 ~l~~l~~~~~~~v~~~a~~il~~~~~~~~~~~~~~~  341 (379)
                      +|+.||+|++++||++|+.||++||.+++++++..|
T Consensus       461 kiE~LQ~hen~~Iy~~A~~II~~yf~~e~~~~~~~~  496 (514)
T KOG0166|consen  461 KIENLQSHENEEIYKKAYKIIDTYFSEEDDEDDQQP  496 (514)
T ss_pred             HHHHhhccccHHHHHHHHHHHHHhcCCCcccccccc
Confidence            999999999999999999999999999876654334



>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0166|consensus Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>KOG4224|consensus Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG4199|consensus Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1048|consensus Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG2122|consensus Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>KOG1222|consensus Back     alignment and domain information
>KOG4500|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>KOG0168|consensus Back     alignment and domain information
>KOG2171|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG2160|consensus Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>KOG1293|consensus Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2759|consensus Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>KOG2023|consensus Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG0946|consensus Back     alignment and domain information
>KOG1241|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2973|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG3678|consensus Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG2734|consensus Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>COG5369 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1059|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG4413|consensus Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG1062|consensus Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1242|consensus Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>KOG0213|consensus Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>COG5231 VMA13 Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG4646|consensus Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1824|consensus Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>KOG0212|consensus Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>KOG4646|consensus Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>KOG1077|consensus Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>KOG2973|consensus Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1061|consensus Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>smart00185 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>KOG2734|consensus Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF09759 Atx10homo_assoc: Spinocerebellar ataxia type 10 protein domain; InterPro: IPR019156 This is the conserved C-terminal 100 residues of Ataxin-10 Back     alignment and domain information
>KOG2259|consensus Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>PF10165 Ric8: Guanine nucleotide exchange factor synembryn; InterPro: IPR019318 Ric8 is involved in the EGL-30 neurotransmitter signalling pathway [] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG4535|consensus Back     alignment and domain information
>KOG3036|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>KOG0915|consensus Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>KOG0211|consensus Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1058|consensus Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG0567|consensus Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1060|consensus Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1991|consensus Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>KOG2274|consensus Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>KOG1248|consensus Back     alignment and domain information
>PF06025 DUF913: Domain of Unknown Function (DUF913); InterPro: IPR010314 This is a domain of unknown function found towards the N terminus of a family of E3 ubiquitin protein ligases, including yeast TOM1, many of which appear to play a role in mRNA transcription and processing Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>KOG1967|consensus Back     alignment and domain information
>KOG1943|consensus Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>KOG3036|consensus Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG1020|consensus Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>KOG2062|consensus Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG1243|consensus Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>PF14668 RICTOR_V: Rapamycin-insensitive companion of mTOR, domain 5 Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>KOG4653|consensus Back     alignment and domain information
>PF13764 E3_UbLigase_R4: E3 ubiquitin-protein ligase UBR4 Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG2032|consensus Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>KOG0414|consensus Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>KOG2025|consensus Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08045 CDC14: Cell division control protein 14, SIN component; InterPro: IPR012535 Cdc14 is a component of the septation initiation network (SIN) and is required for the localisation and activity of Sid1 Back     alignment and domain information
>KOG1078|consensus Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>PF04063 DUF383: Domain of unknown function (DUF383); InterPro: IPR007205 This is a protein of unknown function Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information
>KOG2999|consensus Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>KOG2137|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG1820|consensus Back     alignment and domain information
>KOG1566|consensus Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>KOG2956|consensus Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>KOG1848|consensus Back     alignment and domain information
>KOG2999|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG1566|consensus Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF06685 DUF1186: Protein of unknown function (DUF1186); InterPro: IPR010602 This family consists of several hypothetical bacterial proteins of around 250 residues in length and is found in several Chlamydia and Anabaena species Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>PF06371 Drf_GBD: Diaphanous GTPase-binding Domain; InterPro: IPR010473 Diaphanous-related formins (Drfs) are a family of formin homology (FH) proteins that act as effectors of Rho small GTPases during growth factor-induced cytoskeletal remodelling, stress fibre formation, and cell division [] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>KOG2933|consensus Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>PRK14707 hypothetical protein; Provisional Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG2611|consensus Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>PF07814 WAPL: Wings apart-like protein regulation of heterochromatin; InterPro: IPR022771 This entry contains sequences expressed in eukaryotic organisms (metazoa, fungi, plants) bearing high similarity to the WAPL conserved region of D Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>KOG0413|consensus Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>COG5209 RCD1 Uncharacterized protein involved in cell differentiation/sexual development [General function prediction only] Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>KOG4464|consensus Back     alignment and domain information
>PF14726 RTTN_N: Rotatin, an armadillo repeat protein, centriole functioning Back     alignment and domain information
>PF14225 MOR2-PAG1_C: Cell morphogenesis C-terminal Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>cd03565 VHS_Tom1 VHS domain family, Tom1 subfamily; The VHS domain is an essential part of Tom1 (Target of myb1 - retroviral oncogene) protein Back     alignment and domain information
>PF06685 DUF1186: Protein of unknown function (DUF1186); InterPro: IPR010602 This family consists of several hypothetical bacterial proteins of around 250 residues in length and is found in several Chlamydia and Anabaena species Back     alignment and domain information
>PF08324 PUL: PUL domain; InterPro: IPR013535 The PUL (after PLAP, UFD3 and lub1) domain is a predicted predominantly alpha helical globular domain found in eukaryotes Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain Back     alignment and domain information
>PF12463 DUF3689: Protein of unknown function (DUF3689) ; InterPro: IPR022162 This family of proteins is found in eukaryotes Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG0803|consensus Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>KOG1949|consensus Back     alignment and domain information
>KOG1525|consensus Back     alignment and domain information
>KOG4464|consensus Back     alignment and domain information
>PF12031 DUF3518: Domain of unknown function (DUF3518); InterPro: IPR021906 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG2038|consensus Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF04821 TIMELESS: Timeless protein; InterPro: IPR006906 The timeless gene in Drosophila melanogaster (Fruit fly) and its homologues in a number of other insects and mammals (including human) are involved in circadian rhythm control [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
2jdq_A450 C-Terminal Domain Of Influenza A Virus Polymerase P 1e-139
3tj3_A447 Structure Of Importin A5 Bound To The N-Terminus Of 1e-139
2yns_A490 Rimp_alpha_b54nls Length = 490 1e-102
2yns_A 490 Rimp_alpha_b54nls Length = 490 6e-05
4b8j_A528 Rimp_alpha1a Length = 528 1e-102
4b8j_A 528 Rimp_alpha1a Length = 528 8e-05
1wa5_B530 Crystal Structure Of The Exportin Cse1p Complexed W 2e-97
2c1t_A454 Structure Of The Kap60p:nup2 Complex Length = 454 2e-96
1un0_A443 Crystal Structure Of Yeast Karyopherin (Importin) A 2e-96
1bk5_A422 Karyopherin Alpha From Saccharomyces Cerevisiae Len 2e-95
1bk6_A422 Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Leng 4e-95
1ee5_A424 Yeast Karyopherin (Importin) Alpha In A Complex Wit 1e-94
1ee4_A423 Crystal Structure Of Yeast Karyopherin (Importin) A 7e-94
4ba3_A496 Mimp_alphadibb_a89nls Length = 496 1e-86
3ukw_B510 Mouse Importin Alpha: Bimax1 Peptide Complex Length 1e-86
3rz9_A510 Mouse Importin Alpha-Ku80 Nls Peptide Complex Lengt 1e-86
1ejl_I460 Mouse Importin Alpha-Sv40 Large T Antigen Nls Pepti 1e-86
1q1s_C466 Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptid 2e-86
4htv_A509 Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex 2e-86
3tpo_A529 Crystal Structure Of D192aE396A MUTANT OF MOUSE IMP 7e-86
3fex_C467 Crystal Structure Of The Cbc-Importin Alpha Complex 2e-85
2ynr_A461 Mimp_alphadibb_b54nls Length = 461 1e-83
3l3q_A427 Mouse Importin Alpha-Peptm Nls Peptide Complex Leng 2e-83
3btr_C427 Ar-Nls:importin-Alpha Complex Length = 427 2e-83
3ve6_A426 Crystal Structure Analysis Of Venezuelan Equine Enc 2e-83
1y2a_C428 Structure Of Mammalian Importin Bound To The Non-Cl 2e-83
2c1m_A424 Nup50:importin-Alpha Complex Length = 424 2e-83
3tpm_A422 Crystal Structure Of Mal Rpel Domain In Complex Wit 2e-83
1ial_A453 Importin Alpha, Mouse Length = 453 3e-83
4db8_A252 Designed Armadillo-Repeat Protein Length = 252 3e-38
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 2e-30
4db6_A210 Designed Armadillo Repeat Protein (Yiiim3aii) Lengt 4e-30
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 1e-29
4db9_A210 Designed Armadillo Repeat Protein (Yiiim3aiii) Leng 1e-26
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 2e-29
4dba_A210 Designed Armadillo Repeat Protein (Yiim3aii) Length 9e-28
4hxt_A252 Crystal Structure Of Engineered Protein. Northeast 1e-26
>pdb|2JDQ|A Chain A, C-Terminal Domain Of Influenza A Virus Polymerase Pb2 Subunit In Complex With Human Importin Alpha5 Length = 450 Back     alignment and structure

Iteration: 1

Score = 490 bits (1262), Expect = e-139, Method: Compositional matrix adjust. Identities = 251/353 (71%), Positives = 294/353 (83%), Gaps = 17/353 (4%) Query: 1 MQTRMVIDAGAVPVFIQLLLSPHEDQVTHPSVETMS-------------LDNNILYPLID 47 +QTR+VI AGAVP+FI+LL S ED V +V + LD NIL PL+ Sbjct: 98 LQTRIVIQAGAVPIFIELLSSEFED-VQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQ 156 Query: 48 --KPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAI 105 +NRL+M RN+VW LSNLCRGK+PPP+FAKV+P L LS LLF +D DVLADACWA+ Sbjct: 157 LFSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWAL 216 Query: 106 SYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCS 165 SYLSDGPN+KIQAVIDAGVCRRLVELLMH+ +KVVS ALRAVGNIVTGDD QTQVILNCS Sbjct: 217 SYLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCS 276 Query: 166 ALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRK 225 AL LLHL+ SPKESI+KEACW +SNITAGNR QIQ VIDANIFP+LI ILQ AEF+TRK Sbjct: 277 ALQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRK 336 Query: 226 EAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEA 285 EAAWAITNATSGG+ +QI+YL++ GCI+P C+LLT++D+KI+QVALNGLENIL+LGE+EA Sbjct: 337 EAAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEA 396 Query: 286 KQTGS-VNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDT 337 K+ G+ +NPY LIEE YGLDKIEFLQSHEN EIYQKAFD+IEHYFG+E+ED+ Sbjct: 397 KRNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDS 449
>pdb|3TJ3|A Chain A, Structure Of Importin A5 Bound To The N-Terminus Of Nup50 Length = 447 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|2YNS|A Chain A, Rimp_alpha_b54nls Length = 490 Back     alignment and structure
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|4B8J|A Chain A, Rimp_alpha1a Length = 528 Back     alignment and structure
>pdb|1WA5|B Chain B, Crystal Structure Of The Exportin Cse1p Complexed With Its Cargo (Kap60p) And Rangtp Length = 530 Back     alignment and structure
>pdb|2C1T|A Chain A, Structure Of The Kap60p:nup2 Complex Length = 454 Back     alignment and structure
>pdb|1UN0|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In Complex With A Nup2p N-Terminal Fragment Length = 443 Back     alignment and structure
>pdb|1BK5|A Chain A, Karyopherin Alpha From Saccharomyces Cerevisiae Length = 422 Back     alignment and structure
>pdb|1BK6|A Chain A, Karyopherin Alpha (Yeast) + Sv40 T Antigen Nls Length = 422 Back     alignment and structure
>pdb|1EE5|A Chain A, Yeast Karyopherin (Importin) Alpha In A Complex With A Nucleoplasmin Nls Peptide Length = 424 Back     alignment and structure
>pdb|1EE4|A Chain A, Crystal Structure Of Yeast Karyopherin (Importin) Alpha In A Complex With A C-Myc Nls Peptide Length = 423 Back     alignment and structure
>pdb|4BA3|A Chain A, Mimp_alphadibb_a89nls Length = 496 Back     alignment and structure
>pdb|3UKW|B Chain B, Mouse Importin Alpha: Bimax1 Peptide Complex Length = 510 Back     alignment and structure
>pdb|3RZ9|A Chain A, Mouse Importin Alpha-Ku80 Nls Peptide Complex Length = 510 Back     alignment and structure
>pdb|1EJL|I Chain I, Mouse Importin Alpha-Sv40 Large T Antigen Nls Peptide Complex Length = 460 Back     alignment and structure
>pdb|1Q1S|C Chain C, Mouse Importin Alpha- Phosphorylated Sv40 Cn Peptide Complex Length = 466 Back     alignment and structure
>pdb|4HTV|A Chain A, Mouse Importin Alpha: Bfdv Cap Nls Peptide Complex Length = 509 Back     alignment and structure
>pdb|3TPO|A Chain A, Crystal Structure Of D192aE396A MUTANT OF MOUSE IMPORTIN ALPHA2 Length = 529 Back     alignment and structure
>pdb|3FEX|C Chain C, Crystal Structure Of The Cbc-Importin Alpha Complex. Length = 467 Back     alignment and structure
>pdb|2YNR|A Chain A, Mimp_alphadibb_b54nls Length = 461 Back     alignment and structure
>pdb|3L3Q|A Chain A, Mouse Importin Alpha-Peptm Nls Peptide Complex Length = 427 Back     alignment and structure
>pdb|3BTR|C Chain C, Ar-Nls:importin-Alpha Complex Length = 427 Back     alignment and structure
>pdb|3VE6|A Chain A, Crystal Structure Analysis Of Venezuelan Equine Encephalitis Virus Capsid Protein Nls And Importin Alpha Length = 426 Back     alignment and structure
>pdb|1Y2A|C Chain C, Structure Of Mammalian Importin Bound To The Non-Classical Plscr1-Nls Length = 428 Back     alignment and structure
>pdb|2C1M|A Chain A, Nup50:importin-Alpha Complex Length = 424 Back     alignment and structure
>pdb|3TPM|A Chain A, Crystal Structure Of Mal Rpel Domain In Complex With Importin-Alpha Length = 422 Back     alignment and structure
>pdb|1IAL|A Chain A, Importin Alpha, Mouse Length = 453 Back     alignment and structure
>pdb|4DB8|A Chain A, Designed Armadillo-Repeat Protein Length = 252 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4DB6|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aii) Length = 210 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DB9|A Chain A, Designed Armadillo Repeat Protein (Yiiim3aiii) Length = 210 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|4DBA|A Chain A, Designed Armadillo Repeat Protein (Yiim3aii) Length = 210 Back     alignment and structure
>pdb|4HXT|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or329 Length = 252 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-138
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-36
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 2e-35
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 6e-31
2jdq_A 450 Importin alpha-1 subunit; transport, PB2 subunit, 1e-11
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 1e-125
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 8e-35
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-124
3oqs_A510 Importin subunit alpha-2; importin alpha, karyophe 1e-32
3oqs_A 510 Importin subunit alpha-2; importin alpha, karyophe 2e-30
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 1e-87
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 3e-39
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 2e-38
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 7e-19
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 6e-06
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 2e-80
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 5e-42
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-47
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 2e-43
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 1e-36
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 8e-22
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 5e-21
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-44
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 8e-44
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 3e-31
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-21
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 4e-15
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 1e-12
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-42
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 5e-42
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 2e-39
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 4e-23
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 1e-21
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 9e-42
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 2e-22
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 1e-20
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 3e-12
3nmz_A458 APC variant protein; protein-protein complex, arma 8e-36
3nmz_A458 APC variant protein; protein-protein complex, arma 2e-32
3nmz_A458 APC variant protein; protein-protein complex, arma 4e-25
3nmz_A 458 APC variant protein; protein-protein complex, arma 8e-04
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-33
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 8e-27
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 2e-16
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-28
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 1e-28
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 6e-16
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 8e-25
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-17
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-14
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 1e-06
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 3e-04
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 6e-24
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-14
1xm9_A 457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 1e-14
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 7e-16
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 5e-15
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 1e-13
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 3e-07
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 2e-09
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 3e-07
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 9e-05
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 3e-08
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 6e-06
3grl_A 651 General vesicular transport factor P115; vesicle t 6e-08
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 8e-08
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 3e-07
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 2e-04
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 4e-07
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 1e-05
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 8e-06
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 2e-05
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 2e-05
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
 Score =  401 bits (1032), Expect = e-138
 Identities = 249/352 (70%), Positives = 289/352 (82%), Gaps = 15/352 (4%)

Query: 1   MQTRMVIDAGAVPVFIQLLLSPHEDQVTH------------PSVETMSLDNNILYPLID- 47
           +QTR+VI AGAVP+FI+LL S  ED                       LD NIL PL+  
Sbjct: 98  LQTRIVIQAGAVPIFIELLSSEFEDVQEQAVWALGNIAGDSTMCRDYVLDCNILPPLLQL 157

Query: 48  -KPKNRLSMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAIS 106
              +NRL+M RN+VW LSNLCRGK+PPP+FAKV+P L  LS LLF +D DVLADACWA+S
Sbjct: 158 FSKQNRLTMTRNAVWALSNLCRGKSPPPEFAKVSPCLNVLSWLLFVSDTDVLADACWALS 217

Query: 107 YLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSA 166
           YLSDGPN+KIQAVIDAGVCRRLVELLMH+ +KVVS ALRAVGNIVTGDD QTQVILNCSA
Sbjct: 218 YLSDGPNDKIQAVIDAGVCRRLVELLMHNDYKVVSPALRAVGNIVTGDDIQTQVILNCSA 277

Query: 167 LMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKE 226
           L  LLHL+ SPKESI+KEACW +SNITAGNR QIQ VIDANIFP+LI ILQ AEF+TRKE
Sbjct: 278 LQSLLHLLSSPKESIKKEACWTISNITAGNRAQIQTVIDANIFPALISILQTAEFRTRKE 337

Query: 227 AAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAK 286
           AAWAITNATSGG+ +QI+YL++ GCI+P C+LLT++D+KI+QVALNGLENIL+LGE+EAK
Sbjct: 338 AAWAITNATSGGSAEQIKYLVELGCIKPLCDLLTVMDSKIVQVALNGLENILRLGEQEAK 397

Query: 287 QTG-SVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEEDT 337
           + G  +NPY  LIEE YGLDKIEFLQSHEN EIYQKAFD+IEHYFG+E+ED+
Sbjct: 398 RNGTGINPYCALIEEAYGLDKIEFLQSHENQEIYQKAFDLIEHYFGTEDEDS 449


>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Length = 450 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Length = 530 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>3oqs_A Importin subunit alpha-2; importin alpha, karyopherin alpha, nuclear localisation SIGN recognition, chloride intracellular channel 4, CLIC4 NLS; 2.00A {Mus musculus} PDB: 3rz9_A 3rzx_A 1q1s_C 1q1t_C 3tpo_A 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C 1ial_A 1y2a_C 3btr_C 3l3q_A* 3ve6_A 2c1m_A ... Length = 510 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Length = 252 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Length = 210 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Length = 780 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Length = 529 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Length = 644 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Length = 354 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Length = 458 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Length = 810 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Length = 296 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Length = 584 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Length = 457 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Length = 233 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Length = 280 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Length = 211 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Length = 651 Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Length = 201 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Length = 131 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Length = 778 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 100.0
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 100.0
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 100.0
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 100.0
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3now_A 810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 100.0
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 100.0
3nmz_A458 APC variant protein; protein-protein complex, arma 100.0
2z6h_A644 Catenin beta-1, beta-catenin; C-terminal domain, a 100.0
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 100.0
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 100.0
2z6g_A780 B-catenin; FULL-length, beta-catenin, cell adhesio 100.0
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.98
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.97
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 99.97
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.97
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.97
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 99.97
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.97
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.97
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.96
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.96
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.95
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.95
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.95
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.92
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.88
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.88
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 99.88
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 99.88
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.63
3grl_A 651 General vesicular transport factor P115; vesicle t 99.62
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.61
3grl_A 651 General vesicular transport factor P115; vesicle t 99.61
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.61
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.57
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.56
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.56
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.54
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 99.53
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.53
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.53
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.51
2vgl_B591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.46
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.36
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.36
1w63_A618 Adapter-related protein complex 1 gamma 1 subunit; 99.34
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.34
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 99.28
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.24
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 99.23
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.23
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.22
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.14
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.08
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 99.05
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.0
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 98.99
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.94
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 98.93
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.84
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.83
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.82
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.81
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.81
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.73
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 98.73
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 98.68
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 98.65
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.63
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 98.62
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.55
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.46
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.45
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 98.42
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 98.36
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.19
2x1g_F 971 Cadmus; transport protein, developmental protein, 97.95
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 97.92
2x19_B 963 Importin-13; nuclear transport, protein transport; 97.83
2x1g_F 971 Cadmus; transport protein, developmental protein, 97.72
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 97.7
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 97.69
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.63
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 97.61
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 97.57
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 97.53
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 97.48
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 97.44
2x19_B 963 Importin-13; nuclear transport, protein transport; 97.43
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 97.36
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 97.23
3c2g_A619 SYS-1 protein; beta-catenin, phylogeny, SYS-1, dev 97.19
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 97.09
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 97.08
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.95
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.88
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 96.81
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 96.79
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 96.75
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 96.73
2bnx_A 386 Diaphanous protein homolog 1; autoinhibition, acti 96.34
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 96.28
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 96.06
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 95.92
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 95.9
3ibv_A980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 95.7
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 95.69
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 95.67
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 95.62
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 95.57
3ebb_A304 Phospholipase A2-activating protein; armadillo rep 94.94
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 94.86
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 94.84
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 94.66
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 94.46
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 94.05
3eg5_B383 Protein diaphanous homolog 1; protein-protein comp 93.24
2f31_A233 Diaphanous protein homolog 1; formin,MDIA1, protei 92.84
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 92.47
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 92.36
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 92.18
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 91.09
2bnx_A386 Diaphanous protein homolog 1; autoinhibition, acti 90.89
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 90.73
3o2t_A 386 Symplekin; heat repeat, scaffold, protein binding; 90.49
3o2t_A 386 Symplekin; heat repeat, scaffold, protein binding; 90.17
1vdy_A140 Hypothetical protein (RAFL09-17-B18); structural g 89.96
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 89.91
3qml_C315 Protein SLS1, nucleotide exchange factor SIL1; arm 89.66
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 89.0
3g2s_A149 C-terminal fragment of sortilin-related receptor; 88.96
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 88.7
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 87.28
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 84.62
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 82.93
1elk_A157 Target of MYB1; superhelix of helices, endocytosis 81.28
3g2s_A149 C-terminal fragment of sortilin-related receptor; 81.01
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
Probab=100.00  E-value=1.2e-53  Score=415.75  Aligned_cols=358  Identities=47%  Similarity=0.797  Sum_probs=308.4

Q ss_pred             ChhhhhhhCCChHHHHhhcCCCCCCccc------------CchhHHHHHhCCChHHHHhcC-CCC-----hhHHHHHHHH
Q psy664            1 MQTRMVIDAGAVPVFIQLLLSPHEDQVT------------HPSVETMSLDNNILYPLIDKP-KNR-----LSMVRNSVWV   62 (379)
Q Consensus         1 ~~~~~~~~~g~i~~L~~lL~s~~~~v~~------------~~~~r~~i~~~g~i~~Ll~lL-~~~-----~~~~~~a~~~   62 (379)
                      ++++.+++.|++|.|+++|.+++.++++            ++.+|+.+++.|++++|+.+| ..+     ..++++++|+
T Consensus       153 ~~~~~vv~~Gaip~Lv~LL~s~~~~v~e~A~~aL~nLa~~~~~~r~~i~~~g~i~~Ll~lL~~~~~~~~~~~~~~~a~~~  232 (529)
T 3tpo_A          153 EQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGAGSAFRDLVIKHGAIDPLLALLAVPDLSTLACGYLRNLTWT  232 (529)
T ss_dssp             HHHHHHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHTTCSSCGGGSCHHHHHHHHHH
T ss_pred             HHHHHHHHCCCHHHHHHHHcCCCHHHHHHHHHHHHHHhccCHHHHHHHHHcCCcHHHHHHHhccchhHhHHHHHHHHHHH
Confidence            3688999999999999999999998887            689999999999999999999 332     3578899999


Q ss_pred             HHHHhCCCCCCCChHhHhhhHHHHHHhhcCCChHHHHHHHHHHHHhcCCChHHHHHHHhcCcHHHHHHhhcCCChHHHHH
Q psy664           63 LSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSA  142 (379)
Q Consensus        63 L~~l~~~~~~~~~~~~~~~~l~~L~~lL~~~d~~v~~~a~~aL~~l~~~~~~~~~~~~~~g~i~~L~~lL~~~~~~i~~~  142 (379)
                      ++++|+++.+........+++|.|++++.+++++++..++|+|++++.++++..+.+.+.|+++.|+.+|.+++..++.+
T Consensus       233 L~nl~~~~~~~~~~~~~~~~lp~L~~LL~~~~~~v~~~a~~aL~~l~~~~~~~~~~v~~~g~i~~Lv~lL~~~~~~v~~~  312 (529)
T 3tpo_A          233 LSNLCRNKNPAPPLDAVEQILPTLVRLLHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTP  312 (529)
T ss_dssp             HHHHHCCCTTCCCHHHHHHHHHHHHHHTTSSCHHHHHHHHHHHHHHHSSCHHHHHHHHTTTCHHHHHHHHTCSCHHHHHH
T ss_pred             HHHHHhcccchhhHHHHhhHHHHHHHHhcCCcHHHHHHHHHHHHHhhhhhhhhHHHHHhccchHHHHHHhcCCChhHHHH
Confidence            99999998888888888999999999999999999999999999999999888999999999999999999999999999


Q ss_pred             HHHHHHHhhcCCchhhHHHhhcCcHHHHHHhhcCCChhhHHHHHHHHHHhhcCChHHHHHHHhcCchHHHHHHHHhCcHH
Q psy664          143 ALRAVGNIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFK  222 (379)
Q Consensus       143 al~~L~nl~~~~~~~~~~~~~~~~l~~L~~lL~~~~~~v~~~a~~~l~nl~~~~~~~~~~~~~~~~i~~Li~ll~~~~~~  222 (379)
                      ++++|+|++.+++..+..+++.|+++.|..+|.++++.++++|+|+|+|++.+++++.+.+++.|++|.|+.++.+++++
T Consensus       313 a~~aL~nl~~~~~~~~~~i~~~g~l~~L~~LL~~~~~~i~~~a~~aL~nl~~~~~~~~~~v~~~g~i~~Lv~lL~~~~~~  392 (529)
T 3tpo_A          313 ALRAIGNIVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLVPFLVGVLSKADFK  392 (529)
T ss_dssp             HHHHHHHHTTSCHHHHHHHHHTTGGGGHHHHTTCSSHHHHHHHHHHHHHHHTSCHHHHHHHHHTTHHHHHHHHHHSSCHH
T ss_pred             HHHHHHHHHccchHHHHHHhhcccHHHHHHHHcCCCHHHHHHHHHHHHHHhcccHHHHHHHHhcCcHHHHHHHhcCCCHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHhcCCCHHHHHHHHHcCChHHHHHhhccCCHHHHHHHHHHHHHHHHHcHHhhhhcCCcchHHHHHHHhc
Q psy664          223 TRKEAAWAITNATSGGTPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQTGSVNPYVVLIEECY  302 (379)
Q Consensus       223 v~~~a~~~l~nl~~~~~~~~~~~l~~~~~i~~L~~lL~~~d~~v~~~al~~L~~l~~~~~~~~~~~~~~~~~~~~i~~~g  302 (379)
                      ++++|+|+|+|++..++.+++.++++.|++++|+++|.+.|++++..++++|.+|+..++....    .+.++..|+++|
T Consensus       393 v~~~A~~aL~nl~~~~~~~~~~~l~~~g~i~~L~~LL~~~d~~i~~~~L~aL~nil~~~~~~~~----~~~~~~~iee~g  468 (529)
T 3tpo_A          393 TQKAAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQVILDAISNIFQAAEKLGE----TEKLSIMIEECG  468 (529)
T ss_dssp             HHHHHHHHHHHHHHHSCHHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHHHHHHHHHTTTC----HHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHcCCCHHHHHHHHHCcCHHHHHHHhcCCCHHHHHHHHHHHHHHHHHhHhccC----hHHHHHHHHHCC
Confidence            9999999999999888999999999999999999999999999999999999999998875433    677899999999


Q ss_pred             cHHHHHHhhcCCCHHHHHHHHHHHHHhcCCCcc-cccCCCCcccCCCCCCcccccCCCCCCCCCCcccccCCCCCCCC
Q psy664          303 GLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEE-DTRVAPCVTHDASGAQEFTFAGATQGGACDSTTMLAGGGGGFNF  379 (379)
Q Consensus       303 ~l~~l~~l~~~~~~~v~~~a~~il~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  379 (379)
                      |+++|+.|++|+|++||++|..||++||+++|+ ++++.|+     .+.++|+|+.++            .|.|+|+|
T Consensus       469 gl~~ie~Lq~~~n~~i~~~A~~iie~yf~~~~~~~~~~~~~-----~~~~~~~~~~~~------------~~~~~f~f  529 (529)
T 3tpo_A          469 GLDKIEALQRHENESVYKASLNLIEKYFSVEEEEDQNVVPE-----TTSEGFAFQVQD------------GAPGTFNF  529 (529)
T ss_dssp             CHHHHTGGGGCSSHHHHHHHHHHHHHHC--------------------------------------------------
T ss_pred             cHHHHHHHHcCCCHHHHHHHHHHHHHHCCCccccccccCCC-----CCCcccccCCCC------------CCCCCCCC
Confidence            999999999999999999999999999997654 4578887     456678897642            34578998



>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>3c2g_A SYS-1 protein; beta-catenin, phylogeny, SYS-1, developmental protein, DNA-binding, nucleus; 2.50A {Caenorhabditis elegans} PDB: 3c2h_A* Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3ebb_A Phospholipase A2-activating protein; armadillo repeat, structural genomics consortium, SGC, WD repeat, acetylation, ATP-binding; 1.90A {Homo sapiens} Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3eg5_B Protein diaphanous homolog 1; protein-protein complex, RHO proteins, formins, armadillo repeat, G-protein, GTPase, alternative splicing; HET: GNP; 2.70A {Mus musculus} SCOP: a.118.1.23 PDB: 1z2c_B* Back     alignment and structure
>2f31_A Diaphanous protein homolog 1; formin,MDIA1, protein-protein complex, armadillo repeats, structural protein; 2.10A {Mus musculus} Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2bnx_A Diaphanous protein homolog 1; autoinhibition, actin, nucleation, cytoskeleton, structural; 2.4A {Mus musculus} SCOP: a.118.1.23 PDB: 3o4x_A 3obv_A* 2bap_B Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1vdy_A Hypothetical protein (RAFL09-17-B18); structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Arabidopsis thaliana} PDB: 2dcp_A Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Back     alignment and structure
>3qml_C Protein SLS1, nucleotide exchange factor SIL1; armadillo like repeats, chaperone-protein transport complex; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure
>1elk_A Target of MYB1; superhelix of helices, endocytosis/exocytosis complex; 1.50A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 379
d1wa5b_503 a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (S 3e-69
d1q1sc_434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 7e-50
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 7e-16
d1q1sc_ 434 a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus 3e-09
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-14
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 8e-14
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 9e-14
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-10
d1xm9a1 457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 2e-05
d1xm9a1457 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo 1e-04
d1xqra1264 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (Hsp 6e-10
d1jdha_ 529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 6e-10
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 4e-09
d1jdha_529 a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) 1e-07
d2vglb_579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 6e-09
d2vglb_ 579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 0.001
d2vgla_584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 4e-08
d2vgla_ 584 a.118.1.10 (A:) Adaptin alpha C subunit N-terminal 4e-04
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 9e-08
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 8e-04
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 3e-04
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 503 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score =  224 bits (570), Expect = 3e-69
 Identities = 178/350 (50%), Positives = 242/350 (69%), Gaps = 16/350 (4%)

Query: 2   QTRMVIDAGAVPVFIQLLLSPHEDQVTHP-------SVETMSLDNNILYPLIDKPKNRL- 53
           QT++V+DA AVP+FIQLL +   +            + ++    + +L     +P   L 
Sbjct: 154 QTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLF 213

Query: 54  -----SMVRNSVWVLSNLCRGKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYL 108
                S++R + W LSNLCRGK P PD++ V+ AL  L++L++  D + L DACWAISYL
Sbjct: 214 NSNKPSLIRTATWTLSNLCRGKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYL 273

Query: 109 SDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVGNIVTGDDQQTQVILNCSALM 168
           SDGP E IQAVID  + +RLVELL H+   V + ALRAVGNIVTG+D QTQV++N   L 
Sbjct: 274 SDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVGNIVTGNDLQTQVVINAGVLP 333

Query: 169 CLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAA 228
            L  L+ SPKE+I+KEACW +SNITAGN +QIQAVIDAN+ P L+++L+ AE+KT+KEA 
Sbjct: 334 ALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEAC 393

Query: 229 WAITNATSGGT--PDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAK 286
           WAI+NA+SGG   PD IRYL+ QGCI+P C+LL + D +II+V L+ LENILK+GE + +
Sbjct: 394 WAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKE 453

Query: 287 QTG-SVNPYVVLIEECYGLDKIEFLQSHENIEIYQKAFDIIEHYFGSEEE 335
             G ++N     IE+  G++KI   Q +EN +IY+KA+ IIE YFG EE+
Sbjct: 454 ARGLNINENADFIEKAGGMEKIFNCQQNENDKIYEKAYKIIETYFGEEED 503


>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 434 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 457 Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 264 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Length = 529 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 100.0
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 100.0
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 100.0
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.91
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.86
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 99.85
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.4
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 99.33
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.28
d2vglb_579 Adaptin beta subunit N-terminal fragment {Human (H 99.28
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 99.09
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.08
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.98
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 98.9
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.78
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.71
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.69
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.66
d2vgla_584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.62
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 98.52
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.51
d1u6gc_1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 98.46
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.44
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 98.42
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.41
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 97.56
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 96.71
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 96.7
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 96.35
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 95.91
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 95.88
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 95.54
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 94.98
d2bnxa1343 Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) { 92.38
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 91.78
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 87.6
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 87.16
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 87.06
d1juqa_151 ADP-ribosylation factor binding protein Gga3 {Huma 85.5
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin alpha
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=8.3e-42  Score=328.39  Aligned_cols=334  Identities=53%  Similarity=0.891  Sum_probs=309.5

Q ss_pred             hhhhhhhCCChHHHHhhcCCCCCCccc------------CchhHHHHHhCCChHHHHhcC-CCChhHHHHHHHHHHHHhC
Q psy664            2 QTRMVIDAGAVPVFIQLLLSPHEDQVT------------HPSVETMSLDNNILYPLIDKP-KNRLSMVRNSVWVLSNLCR   68 (379)
Q Consensus         2 ~~~~~~~~g~i~~L~~lL~s~~~~v~~------------~~~~r~~i~~~g~i~~Ll~lL-~~~~~~~~~a~~~L~~l~~   68 (379)
                      ++..+++.|++|.++.+|.+++.++++            ++.+|+.+++.|++++|+.++ +.+..++++++|+|+++|+
T Consensus       154 ~~~~~~~~g~i~~l~~lL~s~~~~i~~~a~~~L~nia~~~~~~r~~l~~~~~~~~L~~ll~~~~~~~~~~~~~~l~nl~~  233 (503)
T d1wa5b_         154 QTKVVVDADAVPLFIQLLYTGSVEVKEQAIWALGNVAGDSTDYRDYVLQCNAMEPILGLFNSNKPSLIRTATWTLSNLCR  233 (503)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHCCHHHHHHHHHHHHHHHTTCHHHHHHHHHTTCHHHHHHGGGSCCHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHhCCChHHHHHHhcCCChhHHHHHHHHHHHHhhhhHHHHHHHHhhcccccchhhcccCCHHHHHHHHHHHHHHhc
Confidence            577899999999999999998888776            689999999999999999999 8888999999999999999


Q ss_pred             CCCCCCChHhHhhhHHHHHHhhcCCChHHHHHHHHHHHHhcCCChHHHHHHHhcCcHHHHHHhhcCCChHHHHHHHHHHH
Q psy664           69 GKTPPPDFAKVAPALACLSRLLFHADPDVLADACWAISYLSDGPNEKIQAVIDAGVCRRLVELLMHDQHKVVSAALRAVG  148 (379)
Q Consensus        69 ~~~~~~~~~~~~~~l~~L~~lL~~~d~~v~~~a~~aL~~l~~~~~~~~~~~~~~g~i~~L~~lL~~~~~~i~~~al~~L~  148 (379)
                      ...+........+++|.++.++.++|++++..++|++++++.+.++....+++.|+++.++.++.+++..++..|+++++
T Consensus       234 ~~~~~~~~~~~~~~l~~l~~~l~~~d~~~~~~~~~~l~~l~~~~~~~~~~~~~~~~~~~l~~ll~~~~~~v~~~al~~l~  313 (503)
T d1wa5b_         234 GKKPQPDWSVVSQALPTLAKLIYSMDTETLVDACWAISYLSDGPQEAIQAVIDVRIPKRLVELLSHESTLVQTPALRAVG  313 (503)
T ss_dssp             CSSSCCCHHHHGGGHHHHHHHTTCCCHHHHHHHHHHHHHHHSSCHHHHHHHHHTTCHHHHHHGGGCSCHHHHHHHHHHHH
T ss_pred             CCccchHHHHHHHHHHHHHHHhccccHHHHHHHHHHHHhhccCCchhhhhhhhhhhhhhhhhcccCCchhhhhhHHHHHH
Confidence            88777888888999999999999999999999999999999998888899999999999999999999999999999999


Q ss_pred             HhhcCCchhhHHHhhcCcHHHHHHhhcCCChhhHHHHHHHHHHhhcCChHHHHHHHhcCchHHHHHHHHhCcHHHHHHHH
Q psy664          149 NIVTGDDQQTQVILNCSALMCLLHLIQSPKESIRKEACWAVSNITAGNRQQIQAVIDANIFPSLIEILQKAEFKTRKEAA  228 (379)
Q Consensus       149 nl~~~~~~~~~~~~~~~~l~~L~~lL~~~~~~v~~~a~~~l~nl~~~~~~~~~~~~~~~~i~~Li~ll~~~~~~v~~~a~  228 (379)
                      |++.+.+.....+.+.|+++.+..+++++++.+++.++|+++|++.++++.+..+++.|+++.++.++.+++++++++|+
T Consensus       314 nl~~~~~~~~~~~~~~~~l~~l~~ll~~~~~~i~~~~~~~l~nl~~~~~~~~~~i~~~~~l~~li~~l~~~~~~v~~~a~  393 (503)
T d1wa5b_         314 NIVTGNDLQTQVVINAGVLPALRLLLSSPKENIKKEACWTISNITAGNTEQIQAVIDANLIPPLVKLLEVAEYKTKKEAC  393 (503)
T ss_dssp             HHTTSCHHHHHHHHHTTHHHHHHHHTTCSCHHHHHHHHHHHHHHTTSCHHHHHHHHHTTCHHHHHHHHHHSCHHHHHHHH
T ss_pred             HHHHHHHHHHHhhhccchHHHHHHHhcCCCHHHHHHHHHHHHHHhhccHHHHHHHHHccccchhHHhcccCChhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCC--CHHHHHHHHHcCChHHHHHhhccCCHHHHHHHHHHHHHHHHHcHHhhhhc-CCcchHHHHHHHhccHH
Q psy664          229 WAITNATSGG--TPDQIRYLIQQGCIEPFCELLTLLDAKIIQVALNGLENILKLGEEEAKQT-GSVNPYVVLIEECYGLD  305 (379)
Q Consensus       229 ~~l~nl~~~~--~~~~~~~l~~~~~i~~L~~lL~~~d~~v~~~al~~L~~l~~~~~~~~~~~-~~~~~~~~~i~~~g~l~  305 (379)
                      |+|+|++..+  .++.+..+++.|++++|+++|+..|.++...++.+|.+++..+....... ...+++...++++|+++
T Consensus       394 ~~l~nl~~~~~~~~~~~~~l~~~~~l~~l~~~L~~~d~~~~~~~L~~l~~ll~~~~~~~~~~~~~~~~~~~~iee~g~~~  473 (503)
T d1wa5b_         394 WAISNASSGGLQRPDIIRYLVSQGCIKPLCDLLEIADNRIIEVTLDALENILKMGEADKEARGLNINENADFIEKAGGME  473 (503)
T ss_dssp             HHHHHHHHHTTTCTHHHHHHHHTTCHHHHHHHTTTCCHHHHHHHHHHHHHHHHHHHHHHHHHTCSSCHHHHHHHHTTHHH
T ss_pred             HHHHHHHhcccccHHHHHHHHHCCcHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHhhhhcccchHHHHHHHHCCCHH
Confidence            9999998644  35678889999999999999999999999999999999998876654322 44688999999999999


Q ss_pred             HHHHhhcCCCHHHHHHHHHHHHHhcCCCcc
Q psy664          306 KIEFLQSHENIEIYQKAFDIIEHYFGSEEE  335 (379)
Q Consensus       306 ~l~~l~~~~~~~v~~~a~~il~~~~~~~~~  335 (379)
                      +|+.|++|++++|+++|..||++||+++||
T Consensus       474 ~i~~Lq~~~~~~i~~~A~~il~~~f~~~~~  503 (503)
T d1wa5b_         474 KIFNCQQNENDKIYEKAYKIIETYFGEEED  503 (503)
T ss_dssp             HHHGGGGCSCHHHHHHHHHHHHHHSSSCC-
T ss_pred             HHHHHHcCCCHHHHHHHHHHHHHHcCCcCC
Confidence            999999999999999999999999987654



>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bnxa1 a.118.1.23 (A:133-475) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure