Diaphorina citri psyllid: psy6650


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MSPLSTPTNPNSTEKHMVHWFRKGLRMHDNPSLREGLKGCTTFRCVFILDPWFAGSSNVGINKWRFLLQCLEDLDINLRKLNSRLFVIRGQPADILPKLFKEWKTTCLTFEEDPEPFGKVRDQNIMTLCRELNIEVIARVSHTLYDLDQLKPDSRG
ccccccccccccccccEEEEEcccccccccHHHHHHHcccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHHcccEEEEEcccCECccccccccccc
****************MVHWFRKGLRMHDNPSLREGLKGCTTFRCVFILDPWFAGSSNVGINKWRFLLQCLEDLDINLRKLNSRLFVIRGQPADILPKLFKEWKTTCLTFEEDPEPFGKVRDQNIMTLCRELNIEVIARVSHTLYDLDQLKPD***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSPLSTPTNPNSTEKHMVHWFRKGLRMHDNPSLREGLKGCTTFRCVFILDPWFAGSSNVGINKWRFLLQCLEDLDINLRKLNSRLFVIRGQPADILPKLFKEWKTTCLTFEEDPEPFGKVRDQNIMTLCRELNIEVIARVSHTLYDLDQLKPDSRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cryptochrome-1 Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.confidentP97784
Cryptochrome-1 Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.confidentQ32Q86
Cryptochrome-1 Blue light-dependent regulator of the circadian feedback loop. Inhibits CLOCK|NPAS2-ARNTL E box-mediated transcription. Acts, in conjunction with CRY2, in maintaining period length and circadian rhythmicity. Has no photolyase activity. Capable of translocating circadian clock core proteins such as PER proteins to the nucleus. May inhibit CLOCK|NPAS2-ARNTL transcriptional activity through stabilizing the unphosphorylated form of ARNTL.confidentQ8QG61

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003914 [MF]DNA (6-4) photolyase activityprobableGO:0003824, GO:0016829, GO:0016830, GO:0003674, GO:0003913
GO:0019902 [MF]phosphatase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0000988 [MF]protein binding transcription factor activityprobableGO:0003674
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003690 [MF]double-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0003904 [MF]deoxyribodipyrimidine photo-lyase activityprobableGO:0003824, GO:0016829, GO:0016830, GO:0003674, GO:0003913
GO:0009416 [BP]response to light stimulusprobableGO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0031974 [CC]membrane-enclosed lumenprobableGO:0005575
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0009266 [BP]response to temperature stimulusprobableGO:0009628, GO:0050896, GO:0008150
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0000719 [BP]photoreactive repairprobableGO:0006290, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0007623 [BP]circadian rhythmprobableGO:0048511, GO:0008150
GO:0009881 [MF]photoreceptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0003684 [MF]damaged DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0006351 [BP]transcription, DNA-dependentprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0003697 [MF]single-stranded DNA bindingprobableGO:0043566, GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0009649 [BP]entrainment of circadian clockprobableGO:0009605, GO:0050896, GO:0042752, GO:0065007, GO:0008150, GO:0050789
GO:0032515 [BP]negative regulation of phosphoprotein phosphatase activityprobableGO:0051336, GO:0051174, GO:0060191, GO:0019220, GO:0043666, GO:0050790, GO:0065009, GO:0010921, GO:0031323, GO:0010923, GO:0019222, GO:0050789, GO:0051004, GO:0065007, GO:0044092, GO:0008150, GO:0035303, GO:0050794, GO:0043086, GO:0051346
GO:2000118 [BP]regulation of sodium-dependent phosphate transportprobableGO:0044070, GO:0051049, GO:0065007, GO:0008150, GO:0010966, GO:0032879, GO:0050789, GO:0043269
GO:0018298 [BP]protein-chromophore linkageprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J4D, chain A
Confidence level:very confident
Coverage over the Query: 4-155
View the alignment between query and template
View the model in PyMOL