Diaphorina citri psyllid: psy665

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MLLFMLSSLDTSDKVGKTTTLSGVILLALYLSCDSFTSNWQGVLFESYKVTSLQMMFGTNLFSCLFTAVSLLQQGGFYQSLHFMLQFPSFTLDCILLSISSAAGQLFVFFTIYKFGAIVFTIIMTVRQGLAILLSCIIYAHPISLLGILGILMVLMAVLLQAYCKLRKASLKKKLNQAEV
cEEEEcccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
MLLFM***********KTTTLSGVILLALYLSCDSFTSNWQGVLFESYKVTSLQMMFGTNLFSCLFTAVSLLQQGGFYQSLHFMLQFPSFTLDCILLSISSAAGQLFVFFTIYKFGAIVFTIIMTVRQGLAILLSCIIYAHPISLLGILGILMVLMAVLLQAYCKLRK************
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLFMLSSLDTSDKVGKTTTLSGVILLALYLSCDSFTSNWQGVLFESYKVTSLQMMFGTNLFSCLFTAVSLLQQGGFYQSLHFMLQFPSFTLDCILLSISSAAGQLFVFFTIYKFGAIVFTIIMTVRQGLAILLSCIIYAHPISLLGILGILMVLMAVLLQAYCKLRKASLKKKLNQAEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenosine 3'-phospho 5'-phosphosulfate transporter 1 Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi.confidentQ5R9A1
Adenosine 3'-phospho 5'-phosphosulfate transporter 1 Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi.confidentQ91ZN5
Adenosine 3'-phospho 5'-phosphosulfate transporter 1 Mediates the transport of adenosine 3'-phospho 5'-phosphosulfate (PAPS), from cytosol into Golgi. PAPS is a universal sulfuryl donor for sulfation events that take place in the Golgi. May indirectly participate in activation of the NF-kappa-B and MAPK pathways.confidentQ8TB61

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046964 [MF]3'-phosphoadenosine 5'-phosphosulfate transmembrane transporter activityprobableGO:0005346, GO:0022891, GO:0015932, GO:1901682, GO:0005337, GO:0000295, GO:0008514, GO:0005215, GO:0008509, GO:0015216, GO:0015211, GO:1901677, GO:0015075, GO:0015215, GO:0022857, GO:0022892, GO:0003674, GO:1901505
GO:0046963 [BP]3'-phosphoadenosine 5'-phosphosulfate transportprobableGO:0015931, GO:0006810, GO:0015868, GO:0015748, GO:0006862, GO:0051503, GO:0015865, GO:0072348, GO:0015711, GO:0015858, GO:0044765, GO:0006820, GO:0071705, GO:0008150, GO:0071702, GO:0051179, GO:0051234, GO:0006811, GO:0044699, GO:1901264
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I68, chain A
Confidence level:probable
Coverage over the Query: 98-164
View the alignment between query and template
View the model in PyMOL