Diaphorina citri psyllid: psy6684


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MYLLEGKKELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHDR
cccccccccHcccccHHHHHHHHccccEEEEccccccccccEEEEEcccccccCEEEHHHHHHHcccccEEEEEEcc
******KKELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRH**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLLEGKKELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHDR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box only protein 11 Substrate recognition component of the a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Binds to and neddylates phosphorylated p53/TP53, inhibiting its transcriptional activity. SCF(FBXO11) does not seem to direct ubiquitination of TP53.confidentQ86XK2
F-box only protein 11 Substrate recognition component of the a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Binds to and neddylates phosphorylated p53/TP53, inhibiting its transcriptional activity. SCF(FBXO11) does not seem to direct ubiquitination of TP53.confidentQ7TSL3
F-box only protein 11 Substrate recognition component of the a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Binds to and neddylates phosphorylated p53/TP53, inhibiting its transcriptional activity. SCF(FBXO11) does not seem to direct ubiquitination of TP53.confidentQ7TPD1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016274 [MF]protein-arginine N-methyltransferase activityprobableGO:0016273, GO:0003824, GO:0008757, GO:0016740, GO:0016741, GO:0008170, GO:0008276, GO:0003674, GO:0008168
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0035246 [BP]peptidyl-arginine N-methylationprobableGO:0006479, GO:0044267, GO:0044238, GO:0044260, GO:0071704, GO:0018216, GO:0044237, GO:0008150, GO:0009987, GO:0018193, GO:0043170, GO:0008213, GO:0018195, GO:0043412, GO:0036211, GO:0043414, GO:0006464, GO:0008152, GO:0019538, GO:0032259
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0070923 [BP]siRNA loading onto RISC involved in chromatin silencing by small RNAprobableGO:0022607, GO:0019219, GO:0080090, GO:0009890, GO:0043933, GO:0031326, GO:0031324, GO:0031323, GO:0040029, GO:0010629, GO:0008150, GO:0034622, GO:0009892, GO:0050789, GO:0044699, GO:0071826, GO:0010605, GO:0019222, GO:0006342, GO:2000112, GO:2000113, GO:0016043, GO:0065003, GO:0031327, GO:0016458, GO:0022618, GO:0065007, GO:0071840, GO:0022613, GO:0048519, GO:0045814, GO:0010468, GO:0045934, GO:0010556, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0031047, GO:0051172, GO:2001141, GO:0031048, GO:0070922, GO:0051253, GO:0051252, GO:0006355, GO:0044085, GO:0044763, GO:0010558, GO:0048523, GO:0051171
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0060966 [BP]regulation of gene silencing by RNAprobableGO:0008150, GO:0050794, GO:0065007, GO:0050789, GO:0060968
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NIS, chain A
Confidence level:confident
Coverage over the Query: 25-75
View the alignment between query and template
View the model in PyMOL