Psyllid ID: psy6684


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MYLLEGKKELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHDR
ccccccccHHHccccHHHHHHHHccccEEEEccccccccccEEEEEcccccccEEEEHHHHHHHcccccEEEEEEcc
cccccccccccccccccHHHHHHccEEEEEEEcccccccccEEEEEEcccccccEEEEEEHHHHccccEEEEEEccc
myllegkkelyLKENWDVQRavtsgqclykissytsfpmhdfyrcqtchttdrnaicvncikschaghdvaFIRHDR
myllegkkELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSchaghdvaFIRHDR
MyllegkkelylkeNWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHDR
******KKELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFI****
*********L***ENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRH**
MYLLEGKKELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHDR
MYL**GKKELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRH**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLLEGKKELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query77 2.2.26 [Sep-21-2011]
Q86XK2927 F-box only protein 11 OS= yes N/A 0.779 0.064 0.816 3e-27
Q7TSL3843 F-box only protein 11 OS= yes N/A 0.779 0.071 0.816 4e-27
Q7TPD1843 F-box only protein 11 OS= yes N/A 0.779 0.071 0.816 4e-27
Q54QG5 5875 Probable E3 ubiquitin-pro yes N/A 0.974 0.012 0.325 5e-05
B9G2A8 4965 Auxin transport protein B yes N/A 0.831 0.012 0.338 0.0002
Q9SRU2 5098 Auxin transport protein B yes N/A 0.831 0.012 0.338 0.0003
>sp|Q86XK2|FBX11_HUMAN F-box only protein 11 OS=Homo sapiens GN=FBXO11 PE=1 SV=3 Back     alignment and function desciption
 Score =  120 bits (300), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 49/60 (81%), Positives = 55/60 (91%)

Query: 18  VQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHDR 77
           +++AV+ GQCLYKISSYTS+PMHDFYRC TC+TTDRNAICVNCIK CH GHDV FIRHDR
Sbjct: 826 IEKAVSRGQCLYKISSYTSYPMHDFYRCHTCNTTDRNAICVNCIKKCHQGHDVEFIRHDR 885




Substrate recognition component of the a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Binds to and neddylates phosphorylated p53/TP53, inhibiting its transcriptional activity. SCF(FBXO11) does not seem to direct ubiquitination of TP53.
Homo sapiens (taxid: 9606)
>sp|Q7TSL3|FBX11_RAT F-box only protein 11 OS=Rattus norvegicus GN=Fbxo11 PE=2 SV=1 Back     alignment and function description
>sp|Q7TPD1|FBX11_MOUSE F-box only protein 11 OS=Mus musculus GN=Fbxo11 PE=2 SV=2 Back     alignment and function description
>sp|Q54QG5|Y3893_DICDI Probable E3 ubiquitin-protein ligase DDB_G0283893 OS=Dictyostelium discoideum GN=DDB_G0283893 PE=3 SV=2 Back     alignment and function description
>sp|B9G2A8|BIG_ORYSJ Auxin transport protein BIG OS=Oryza sativa subsp. japonica GN=Os09g0247700 PE=2 SV=1 Back     alignment and function description
>sp|Q9SRU2|BIG_ARATH Auxin transport protein BIG OS=Arabidopsis thaliana GN=BIG PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
195572137 1183 GD20755 [Drosophila simulans] gi|1941999 0.792 0.051 0.885 2e-29
195330247 1183 GM26208 [Drosophila sechellia] gi|194120 0.792 0.051 0.885 2e-29
33636651 1124 GM01353p [Drosophila melanogaster] 0.792 0.054 0.885 2e-29
195499617 1181 GE24725 [Drosophila yakuba] gi|194183126 0.792 0.051 0.885 2e-29
194902666 1177 GG17321 [Drosophila erecta] gi|190652444 0.792 0.051 0.885 2e-29
24645532 1182 FBX011 ortholog, isoform A [Drosophila m 0.792 0.051 0.885 2e-29
195454322 1170 GK14511 [Drosophila willistoni] gi|19417 0.792 0.052 0.885 2e-29
195037623 1202 GH18333 [Drosophila grimshawi] gi|193894 0.792 0.050 0.885 3e-29
194742211 1185 GF17149 [Drosophila ananassae] gi|190626 0.792 0.051 0.885 3e-29
198451988 1175 GA21805 [Drosophila pseudoobscura pseudo 0.792 0.051 0.885 4e-29
>gi|195572137|ref|XP_002104053.1| GD20755 [Drosophila simulans] gi|194199980|gb|EDX13556.1| GD20755 [Drosophila simulans] Back     alignment and taxonomy information
 Score =  133 bits (334), Expect = 2e-29,   Method: Composition-based stats.
 Identities = 54/61 (88%), Positives = 60/61 (98%)

Query: 17   DVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHD 76
            +V++AV+SGQCLYKISSYTSFPMHDFYRCQTC+TTDRNAICVNCIK+CHAGHDV FIRHD
Sbjct: 1081 EVEKAVSSGQCLYKISSYTSFPMHDFYRCQTCNTTDRNAICVNCIKNCHAGHDVEFIRHD 1140

Query: 77   R 77
            R
Sbjct: 1141 R 1141




Source: Drosophila simulans

Species: Drosophila simulans

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195330247|ref|XP_002031816.1| GM26208 [Drosophila sechellia] gi|194120759|gb|EDW42802.1| GM26208 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|33636651|gb|AAQ23623.1| GM01353p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195499617|ref|XP_002097025.1| GE24725 [Drosophila yakuba] gi|194183126|gb|EDW96737.1| GE24725 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194902666|ref|XP_001980741.1| GG17321 [Drosophila erecta] gi|190652444|gb|EDV49699.1| GG17321 [Drosophila erecta] Back     alignment and taxonomy information
>gi|24645532|ref|NP_649954.1| FBX011 ortholog, isoform A [Drosophila melanogaster] gi|442618351|ref|NP_001262441.1| FBX011 ortholog, isoform B [Drosophila melanogaster] gi|7299263|gb|AAF54459.1| FBX011 ortholog, isoform A [Drosophila melanogaster] gi|440217278|gb|AGB95823.1| FBX011 ortholog, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195454322|ref|XP_002074189.1| GK14511 [Drosophila willistoni] gi|194170274|gb|EDW85175.1| GK14511 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195037623|ref|XP_001990260.1| GH18333 [Drosophila grimshawi] gi|193894456|gb|EDV93322.1| GH18333 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|194742211|ref|XP_001953599.1| GF17149 [Drosophila ananassae] gi|190626636|gb|EDV42160.1| GF17149 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|198451988|ref|XP_001358574.2| GA21805 [Drosophila pseudoobscura pseudoobscura] gi|198131738|gb|EAL27715.2| GA21805 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
FB|FBgn00377601182 FBX011 "FBX011 ortholog" [Dros 0.792 0.051 0.885 4.3e-27
UNIPROTKB|B3KUR1351 FBXO11 "cDNA FLJ40415 fis, clo 0.818 0.179 0.796 3.2e-26
MGI|MGI:2147134843 Fbxo11 "F-box protein 11" [Mus 0.818 0.074 0.796 4.2e-25
RGD|727935843 Fbxo11 "F-box protein 11" [Rat 0.818 0.074 0.796 4.2e-25
UNIPROTKB|Q7TSL3843 Fbxo11 "F-box only protein 11" 0.818 0.074 0.796 4.2e-25
UNIPROTKB|F1PLE4872 FBXO11 "Uncharacterized protei 0.818 0.072 0.796 4.5e-25
UNIPROTKB|F1NV53879 FBXO11 "Uncharacterized protei 0.818 0.071 0.796 4.5e-25
ZFIN|ZDB-GENE-061103-70879 fbxo11a "F-box protein 11a" [D 0.818 0.071 0.796 4.5e-25
UNIPROTKB|Q86XK2927 FBXO11 "F-box only protein 11" 0.818 0.067 0.796 5e-25
UNIPROTKB|I3LN00928 FBXO11 "Uncharacterized protei 0.818 0.067 0.796 5e-25
FB|FBgn0037760 FBX011 "FBX011 ortholog" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 317 (116.6 bits), Expect = 4.3e-27, P = 4.3e-27
 Identities = 54/61 (88%), Positives = 60/61 (98%)

Query:    17 DVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHD 76
             +V++AV+SGQCLYKISSYTSFPMHDFYRCQTC+TTDRNAICVNCIK+CHAGHDV FIRHD
Sbjct:  1080 EVEKAVSSGQCLYKISSYTSFPMHDFYRCQTCNTTDRNAICVNCIKNCHAGHDVEFIRHD 1139

Query:    77 R 77
             R
Sbjct:  1140 R 1140




GO:0004842 "ubiquitin-protein ligase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0070923 "siRNA loading onto RISC involved in chromatin silencing by small RNA" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0060966 "regulation of gene silencing by RNA" evidence=IMP
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
UNIPROTKB|B3KUR1 FBXO11 "cDNA FLJ40415 fis, clone TESTI2038104, highly similar to F-box only protein 11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2147134 Fbxo11 "F-box protein 11" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|727935 Fbxo11 "F-box protein 11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q7TSL3 Fbxo11 "F-box only protein 11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PLE4 FBXO11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NV53 FBXO11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061103-70 fbxo11a "F-box protein 11a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q86XK2 FBXO11 "F-box only protein 11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LN00 FBXO11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q86XK2FBX11_HUMANNo assigned EC number0.81660.77920.0647yesN/A
Q7TSL3FBX11_RATNo assigned EC number0.81660.77920.0711yesN/A
Q7TPD1FBX11_MOUSENo assigned EC number0.81660.77920.0711yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query77
pfam0220771 pfam02207, zf-UBR, Putative zinc finger in N-recog 1e-07
smart0039671 smart00396, ZnF_UBR1, Putative zinc finger in N-re 1e-04
>gnl|CDD|216929 pfam02207, zf-UBR, Putative zinc finger in N-recognin (UBR box) Back     alignment and domain information
 Score = 43.9 bits (104), Expect = 1e-07
 Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 1/49 (2%)

Query: 30 KISSYTSFPMHDFYRCQTCHTTDRNAICVNC-IKSCHAGHDVAFIRHDR 77
           +  Y        YRC TC       IC  C   SCH GHDV  +   R
Sbjct: 1  SVCGYVFKSGQPVYRCLTCSLDPTCVICYECFSISCHKGHDVVELFSKR 49


This region is found in E3 ubiquitin ligases that recognise N-recognins. Length = 71

>gnl|CDD|197698 smart00396, ZnF_UBR1, Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 77
KOG1777|consensus625 99.94
KOG0943|consensus 3015 99.47
PF0220771 zf-UBR: Putative zinc finger in N-recognin (UBR bo 99.38
smart0039671 ZnF_UBR1 Putative zinc finger in N-recognin, a rec 98.99
KOG1776|consensus 1110 98.33
KOG2752|consensus 345 97.68
PF0064342 zf-B_box: B-box zinc finger; InterPro: IPR000315 Z 96.15
smart0033642 BBOX B-Box-type zinc finger. 93.87
cd0002139 BBOX B-Box-type zinc finger; zinc binding domain ( 93.22
>KOG1777|consensus Back     alignment and domain information
Probab=99.94  E-value=2.3e-27  Score=193.43  Aligned_cols=72  Identities=64%  Similarity=1.203  Sum_probs=70.4

Q ss_pred             cccccccCCchhHHhhhhCCcceEEeecCcccceeceEEeecCCCCCCeeeehhhHHhhcCCCceEEeeeCC
Q psy6684           6 GKKELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHDR   77 (77)
Q Consensus         6 ~k~~~~~~n~d~~e~al~~~~Ctf~~st~~~f~~Q~~Y~C~TC~~~d~~giC~~Ca~~CH~GHdv~y~r~sR   77 (77)
                      -+.|.||+|+|.||+|++.++|+|++|++++|||++||+|.|||++|+|+||.+|++.||+||+|+|+|+||
T Consensus       525 ~~~N~iydN~D~vekAik~GqCLfkvSs~~syPMHnFYRC~TCNttdRNAIC~nCI~~CH~GH~Vefir~Dr  596 (625)
T KOG1777|consen  525 ERGNQIYDNLDHVEKAIKKGQCLFKVSSYTSYPMHNFYRCITCNTTDRNAICVNCIKRCHEGHDVEFIRHDR  596 (625)
T ss_pred             ccccccccchHHHHHHhhcCceEEEecCCCcccccceeEeeecCCccccHHHHHHHHHhcCCCceEEEeece
Confidence            467999999999999999999999999999999999999999999999999999999999999999999998



>KOG0943|consensus Back     alignment and domain information
>PF02207 zf-UBR: Putative zinc finger in N-recognin (UBR box); InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway Back     alignment and domain information
>KOG1776|consensus Back     alignment and domain information
>KOG2752|consensus Back     alignment and domain information
>PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00336 BBOX B-Box-type zinc finger Back     alignment and domain information
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
3ny3_A75 E3 ubiquitin-protein ligase UBR2; zinc finger-like 96.47
3nis_A82 E3 ubiquitin-protein ligase UBR1; E3 ubiquitin lig 96.41
2yvr_A50 Transcription intermediary factor 1-beta; ZF-B_BOX 94.3
3ddt_A48 E3 ubiquitin-protein ligase TRIM63; zinc-binding m 93.55
2did_A53 Tripartite motif protein 39; ZF-B-box domian, Zn b 92.8
2d8u_A64 Ubiquitin ligase TRIM63; tripartite motif-containi 92.68
2csv_A72 Tripartite motif protein 29; ZF-B_BOX domain, TRIM 92.34
2dja_A84 Midline-2; tripartite motif protein 1, ZF-B_BOX, s 91.73
2yrg_A59 Tripartite motif-containing protein 5; B-box domai 90.48
2egm_A57 Tripartite motif-containing protein 41; ZF-B_BOX d 88.22
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 85.49
1fre_A42 Nuclear factor XNF7; zinc-binding protein, BBOX, d 85.4
>3ny3_A E3 ubiquitin-protein ligase UBR2; zinc finger-like, ubiquitin ligase, protein binding, lygase,; 1.60A {Homo sapiens} PDB: 3ny2_A 3ny1_A Back     alignment and structure
Probab=96.47  E-value=0.0021  Score=40.03  Aligned_cols=36  Identities=19%  Similarity=0.552  Sum_probs=31.8

Q ss_pred             eeceEEeecCCCCCCeeeehhhHHh-hcCCCceEEee
Q psy6684          39 MHDFYRCQTCHTTDRNAICVNCIKS-CHAGHDVAFIR   74 (77)
Q Consensus        39 ~Q~~Y~C~TC~~~d~~giC~~Ca~~-CH~GHdv~y~r   74 (77)
                      ....|+|.||.+.+.-.+|..|-+. =|+||++...+
T Consensus        14 ge~~Y~C~~C~~d~tc~lC~~CF~~~~H~gH~~~~~~   50 (75)
T 3ny3_A           14 GEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTT   50 (75)
T ss_dssp             TCEEEEETTTBSSTTCCBCHHHHHTSGGGGSCEEEEE
T ss_pred             CCEEEECccCCCCCCeeEChHHCCCCCcCCceEEEEE
Confidence            4568999999999988999999876 79999998875



>3nis_A E3 ubiquitin-protein ligase UBR1; E3 ubiquitin ligase, UBR BOX, zinc-binding protein, N-END RU ligase, metal binding protein; 1.68A {Saccharomyces cerevisiae} PDB: 3nii_A 3nij_A 3nih_A 3nik_A 3nim_A 3nin_A 3nil_A 3nit_A Back     alignment and structure
>2yvr_A Transcription intermediary factor 1-beta; ZF-B_BOX domain, structural genomics, NPPSFA; 1.80A {Homo sapiens} Back     alignment and structure
>3ddt_A E3 ubiquitin-protein ligase TRIM63; zinc-binding motif, ring-like fold, coiled coil, cytoplasm, metal-binding, muscle protein, nucleus; 1.90A {Homo sapiens} SCOP: g.43.1.1 PDB: 3q1d_A Back     alignment and structure
>2did_A Tripartite motif protein 39; ZF-B-box domian, Zn binding, one sequence two fold, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dif_A Back     alignment and structure
>2d8u_A Ubiquitin ligase TRIM63; tripartite motif-containing 63, muscle-specific ring finger protein 1, MURF1, ring finger protein 28; NMR {Homo sapiens} SCOP: g.43.1.1 Back     alignment and structure
>2csv_A Tripartite motif protein 29; ZF-B_BOX domain, TRIM29, ataxia-telangiectasia group D-associated protein, ATDC, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 Back     alignment and structure
>2dja_A Midline-2; tripartite motif protein 1, ZF-B_BOX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dq5_A Back     alignment and structure
>2yrg_A Tripartite motif-containing protein 5; B-box domain, ring finger protein 88, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egm_A Tripartite motif-containing protein 41; ZF-B_BOX domain, tripartite motif protein 41, TRIM41, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1fre_A Nuclear factor XNF7; zinc-binding protein, BBOX, development, MID-blastula- transition; NMR {Xenopus laevis} SCOP: g.43.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
d2dq5a147 Midline-1 {Human (Homo sapiens) [TaxId: 9606]} 94.68
d2csva159 Tripartite motif-containing protein 29 {Human (Hom 94.61
d2djaa171 Midline-2 {Human (Homo sapiens) [TaxId: 9606]} 94.56
d2dida140 Tripartite motif-containing protein 39 {Human (Hom 94.11
d2d8ua151 Ubiquitin ligase trim63 {Human (Homo sapiens) [Tax 92.8
d1frea_39 Nuclear factor XNF7 {African clawed frog (Xenopus 88.89
>d2dq5a1 g.43.1.1 (A:168-214) Midline-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: B-box zinc-binding domain
superfamily: B-box zinc-binding domain
family: B-box zinc-binding domain
domain: Midline-1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=94.68  E-value=0.0062  Score=32.93  Aligned_cols=28  Identities=32%  Similarity=0.395  Sum_probs=23.6

Q ss_pred             ceEEeecCCCCCCeeeehhhHHh-hcCCCceEE
Q psy6684          41 DFYRCQTCHTTDRNAICVNCIKS-CHAGHDVAF   72 (77)
Q Consensus        41 ~~Y~C~TC~~~d~~giC~~Ca~~-CH~GHdv~y   72 (77)
                      --|.|.||..    .||..|+.. =|+||++.-
T Consensus        16 l~~yC~~C~~----~iC~~C~~~~~H~~H~~~~   44 (47)
T d2dq5a1          16 VNMYCVTDDQ----LICALCKLVGRHRDHQVAA   44 (47)
T ss_dssp             EEEEETTTTE----EEEHHHHHTSSTTSSCCCC
T ss_pred             ceEEcCCCCc----cCCccCcCcCCcCCCeEee
Confidence            4689999997    899999865 599999864



>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djaa1 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ua1 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure