Psyllid ID: psy6684
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 77 | ||||||
| 195572137 | 1183 | GD20755 [Drosophila simulans] gi|1941999 | 0.792 | 0.051 | 0.885 | 2e-29 | |
| 195330247 | 1183 | GM26208 [Drosophila sechellia] gi|194120 | 0.792 | 0.051 | 0.885 | 2e-29 | |
| 33636651 | 1124 | GM01353p [Drosophila melanogaster] | 0.792 | 0.054 | 0.885 | 2e-29 | |
| 195499617 | 1181 | GE24725 [Drosophila yakuba] gi|194183126 | 0.792 | 0.051 | 0.885 | 2e-29 | |
| 194902666 | 1177 | GG17321 [Drosophila erecta] gi|190652444 | 0.792 | 0.051 | 0.885 | 2e-29 | |
| 24645532 | 1182 | FBX011 ortholog, isoform A [Drosophila m | 0.792 | 0.051 | 0.885 | 2e-29 | |
| 195454322 | 1170 | GK14511 [Drosophila willistoni] gi|19417 | 0.792 | 0.052 | 0.885 | 2e-29 | |
| 195037623 | 1202 | GH18333 [Drosophila grimshawi] gi|193894 | 0.792 | 0.050 | 0.885 | 3e-29 | |
| 194742211 | 1185 | GF17149 [Drosophila ananassae] gi|190626 | 0.792 | 0.051 | 0.885 | 3e-29 | |
| 198451988 | 1175 | GA21805 [Drosophila pseudoobscura pseudo | 0.792 | 0.051 | 0.885 | 4e-29 |
| >gi|195572137|ref|XP_002104053.1| GD20755 [Drosophila simulans] gi|194199980|gb|EDX13556.1| GD20755 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
Score = 133 bits (334), Expect = 2e-29, Method: Composition-based stats.
Identities = 54/61 (88%), Positives = 60/61 (98%)
Query: 17 DVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHD 76
+V++AV+SGQCLYKISSYTSFPMHDFYRCQTC+TTDRNAICVNCIK+CHAGHDV FIRHD
Sbjct: 1081 EVEKAVSSGQCLYKISSYTSFPMHDFYRCQTCNTTDRNAICVNCIKNCHAGHDVEFIRHD 1140
Query: 77 R 77
R
Sbjct: 1141 R 1141
|
Source: Drosophila simulans Species: Drosophila simulans Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195330247|ref|XP_002031816.1| GM26208 [Drosophila sechellia] gi|194120759|gb|EDW42802.1| GM26208 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|33636651|gb|AAQ23623.1| GM01353p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195499617|ref|XP_002097025.1| GE24725 [Drosophila yakuba] gi|194183126|gb|EDW96737.1| GE24725 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|194902666|ref|XP_001980741.1| GG17321 [Drosophila erecta] gi|190652444|gb|EDV49699.1| GG17321 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|24645532|ref|NP_649954.1| FBX011 ortholog, isoform A [Drosophila melanogaster] gi|442618351|ref|NP_001262441.1| FBX011 ortholog, isoform B [Drosophila melanogaster] gi|7299263|gb|AAF54459.1| FBX011 ortholog, isoform A [Drosophila melanogaster] gi|440217278|gb|AGB95823.1| FBX011 ortholog, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195454322|ref|XP_002074189.1| GK14511 [Drosophila willistoni] gi|194170274|gb|EDW85175.1| GK14511 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195037623|ref|XP_001990260.1| GH18333 [Drosophila grimshawi] gi|193894456|gb|EDV93322.1| GH18333 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|194742211|ref|XP_001953599.1| GF17149 [Drosophila ananassae] gi|190626636|gb|EDV42160.1| GF17149 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|198451988|ref|XP_001358574.2| GA21805 [Drosophila pseudoobscura pseudoobscura] gi|198131738|gb|EAL27715.2| GA21805 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 77 | ||||||
| FB|FBgn0037760 | 1182 | FBX011 "FBX011 ortholog" [Dros | 0.792 | 0.051 | 0.885 | 4.3e-27 | |
| UNIPROTKB|B3KUR1 | 351 | FBXO11 "cDNA FLJ40415 fis, clo | 0.818 | 0.179 | 0.796 | 3.2e-26 | |
| MGI|MGI:2147134 | 843 | Fbxo11 "F-box protein 11" [Mus | 0.818 | 0.074 | 0.796 | 4.2e-25 | |
| RGD|727935 | 843 | Fbxo11 "F-box protein 11" [Rat | 0.818 | 0.074 | 0.796 | 4.2e-25 | |
| UNIPROTKB|Q7TSL3 | 843 | Fbxo11 "F-box only protein 11" | 0.818 | 0.074 | 0.796 | 4.2e-25 | |
| UNIPROTKB|F1PLE4 | 872 | FBXO11 "Uncharacterized protei | 0.818 | 0.072 | 0.796 | 4.5e-25 | |
| UNIPROTKB|F1NV53 | 879 | FBXO11 "Uncharacterized protei | 0.818 | 0.071 | 0.796 | 4.5e-25 | |
| ZFIN|ZDB-GENE-061103-70 | 879 | fbxo11a "F-box protein 11a" [D | 0.818 | 0.071 | 0.796 | 4.5e-25 | |
| UNIPROTKB|Q86XK2 | 927 | FBXO11 "F-box only protein 11" | 0.818 | 0.067 | 0.796 | 5e-25 | |
| UNIPROTKB|I3LN00 | 928 | FBXO11 "Uncharacterized protei | 0.818 | 0.067 | 0.796 | 5e-25 |
| FB|FBgn0037760 FBX011 "FBX011 ortholog" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 317 (116.6 bits), Expect = 4.3e-27, P = 4.3e-27
Identities = 54/61 (88%), Positives = 60/61 (98%)
Query: 17 DVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHD 76
+V++AV+SGQCLYKISSYTSFPMHDFYRCQTC+TTDRNAICVNCIK+CHAGHDV FIRHD
Sbjct: 1080 EVEKAVSSGQCLYKISSYTSFPMHDFYRCQTCNTTDRNAICVNCIKNCHAGHDVEFIRHD 1139
Query: 77 R 77
R
Sbjct: 1140 R 1140
|
|
| UNIPROTKB|B3KUR1 FBXO11 "cDNA FLJ40415 fis, clone TESTI2038104, highly similar to F-box only protein 11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2147134 Fbxo11 "F-box protein 11" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|727935 Fbxo11 "F-box protein 11" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7TSL3 Fbxo11 "F-box only protein 11" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PLE4 FBXO11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NV53 FBXO11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-061103-70 fbxo11a "F-box protein 11a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86XK2 FBXO11 "F-box only protein 11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LN00 FBXO11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 77 | |||
| pfam02207 | 71 | pfam02207, zf-UBR, Putative zinc finger in N-recog | 1e-07 | |
| smart00396 | 71 | smart00396, ZnF_UBR1, Putative zinc finger in N-re | 1e-04 |
| >gnl|CDD|216929 pfam02207, zf-UBR, Putative zinc finger in N-recognin (UBR box) | Back alignment and domain information |
|---|
Score = 43.9 bits (104), Expect = 1e-07
Identities = 17/49 (34%), Positives = 19/49 (38%), Gaps = 1/49 (2%)
Query: 30 KISSYTSFPMHDFYRCQTCHTTDRNAICVNC-IKSCHAGHDVAFIRHDR 77
+ Y YRC TC IC C SCH GHDV + R
Sbjct: 1 SVCGYVFKSGQPVYRCLTCSLDPTCVICYECFSISCHKGHDVVELFSKR 49
|
This region is found in E3 ubiquitin ligases that recognise N-recognins. Length = 71 |
| >gnl|CDD|197698 smart00396, ZnF_UBR1, Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 77 | |||
| KOG1777|consensus | 625 | 99.94 | ||
| KOG0943|consensus | 3015 | 99.47 | ||
| PF02207 | 71 | zf-UBR: Putative zinc finger in N-recognin (UBR bo | 99.38 | |
| smart00396 | 71 | ZnF_UBR1 Putative zinc finger in N-recognin, a rec | 98.99 | |
| KOG1776|consensus | 1110 | 98.33 | ||
| KOG2752|consensus | 345 | 97.68 | ||
| PF00643 | 42 | zf-B_box: B-box zinc finger; InterPro: IPR000315 Z | 96.15 | |
| smart00336 | 42 | BBOX B-Box-type zinc finger. | 93.87 | |
| cd00021 | 39 | BBOX B-Box-type zinc finger; zinc binding domain ( | 93.22 |
| >KOG1777|consensus | Back alignment and domain information |
|---|
Probab=99.94 E-value=2.3e-27 Score=193.43 Aligned_cols=72 Identities=64% Similarity=1.203 Sum_probs=70.4
Q ss_pred cccccccCCchhHHhhhhCCcceEEeecCcccceeceEEeecCCCCCCeeeehhhHHhhcCCCceEEeeeCC
Q psy6684 6 GKKELYLKENWDVQRAVTSGQCLYKISSYTSFPMHDFYRCQTCHTTDRNAICVNCIKSCHAGHDVAFIRHDR 77 (77)
Q Consensus 6 ~k~~~~~~n~d~~e~al~~~~Ctf~~st~~~f~~Q~~Y~C~TC~~~d~~giC~~Ca~~CH~GHdv~y~r~sR 77 (77)
-+.|.||+|+|.||+|++.++|+|++|++++|||++||+|.|||++|+|+||.+|++.||+||+|+|+|+||
T Consensus 525 ~~~N~iydN~D~vekAik~GqCLfkvSs~~syPMHnFYRC~TCNttdRNAIC~nCI~~CH~GH~Vefir~Dr 596 (625)
T KOG1777|consen 525 ERGNQIYDNLDHVEKAIKKGQCLFKVSSYTSYPMHNFYRCITCNTTDRNAICVNCIKRCHEGHDVEFIRHDR 596 (625)
T ss_pred ccccccccchHHHHHHhhcCceEEEecCCCcccccceeEeeecCCccccHHHHHHHHHhcCCCceEEEeece
Confidence 467999999999999999999999999999999999999999999999999999999999999999999998
|
|
| >KOG0943|consensus | Back alignment and domain information |
|---|
| >PF02207 zf-UBR: Putative zinc finger in N-recognin (UBR box); InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway | Back alignment and domain information |
|---|
| >KOG1776|consensus | Back alignment and domain information |
|---|
| >KOG2752|consensus | Back alignment and domain information |
|---|
| >PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00336 BBOX B-Box-type zinc finger | Back alignment and domain information |
|---|
| >cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
No hit with e-value below 0.005
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 77 | |||
| 3ny3_A | 75 | E3 ubiquitin-protein ligase UBR2; zinc finger-like | 96.47 | |
| 3nis_A | 82 | E3 ubiquitin-protein ligase UBR1; E3 ubiquitin lig | 96.41 | |
| 2yvr_A | 50 | Transcription intermediary factor 1-beta; ZF-B_BOX | 94.3 | |
| 3ddt_A | 48 | E3 ubiquitin-protein ligase TRIM63; zinc-binding m | 93.55 | |
| 2did_A | 53 | Tripartite motif protein 39; ZF-B-box domian, Zn b | 92.8 | |
| 2d8u_A | 64 | Ubiquitin ligase TRIM63; tripartite motif-containi | 92.68 | |
| 2csv_A | 72 | Tripartite motif protein 29; ZF-B_BOX domain, TRIM | 92.34 | |
| 2dja_A | 84 | Midline-2; tripartite motif protein 1, ZF-B_BOX, s | 91.73 | |
| 2yrg_A | 59 | Tripartite motif-containing protein 5; B-box domai | 90.48 | |
| 2egm_A | 57 | Tripartite motif-containing protein 41; ZF-B_BOX d | 88.22 | |
| 2jun_A | 101 | Midline-1; B-BOX, TRIM, ring finger, alternative s | 85.49 | |
| 1fre_A | 42 | Nuclear factor XNF7; zinc-binding protein, BBOX, d | 85.4 |
| >3ny3_A E3 ubiquitin-protein ligase UBR2; zinc finger-like, ubiquitin ligase, protein binding, lygase,; 1.60A {Homo sapiens} PDB: 3ny2_A 3ny1_A | Back alignment and structure |
|---|
Probab=96.47 E-value=0.0021 Score=40.03 Aligned_cols=36 Identities=19% Similarity=0.552 Sum_probs=31.8
Q ss_pred eeceEEeecCCCCCCeeeehhhHHh-hcCCCceEEee
Q psy6684 39 MHDFYRCQTCHTTDRNAICVNCIKS-CHAGHDVAFIR 74 (77)
Q Consensus 39 ~Q~~Y~C~TC~~~d~~giC~~Ca~~-CH~GHdv~y~r 74 (77)
....|+|.||.+.+.-.+|..|-+. =|+||++...+
T Consensus 14 ge~~Y~C~~C~~d~tc~lC~~CF~~~~H~gH~~~~~~ 50 (75)
T 3ny3_A 14 GEPTYSCRDCAVDPTCVLCMECFLGSIHRDHRYRMTT 50 (75)
T ss_dssp TCEEEEETTTBSSTTCCBCHHHHHTSGGGGSCEEEEE
T ss_pred CCEEEECccCCCCCCeeEChHHCCCCCcCCceEEEEE
Confidence 4568999999999988999999876 79999998875
|
| >3nis_A E3 ubiquitin-protein ligase UBR1; E3 ubiquitin ligase, UBR BOX, zinc-binding protein, N-END RU ligase, metal binding protein; 1.68A {Saccharomyces cerevisiae} PDB: 3nii_A 3nij_A 3nih_A 3nik_A 3nim_A 3nin_A 3nil_A 3nit_A | Back alignment and structure |
|---|
| >2yvr_A Transcription intermediary factor 1-beta; ZF-B_BOX domain, structural genomics, NPPSFA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ddt_A E3 ubiquitin-protein ligase TRIM63; zinc-binding motif, ring-like fold, coiled coil, cytoplasm, metal-binding, muscle protein, nucleus; 1.90A {Homo sapiens} SCOP: g.43.1.1 PDB: 3q1d_A | Back alignment and structure |
|---|
| >2did_A Tripartite motif protein 39; ZF-B-box domian, Zn binding, one sequence two fold, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dif_A | Back alignment and structure |
|---|
| >2d8u_A Ubiquitin ligase TRIM63; tripartite motif-containing 63, muscle-specific ring finger protein 1, MURF1, ring finger protein 28; NMR {Homo sapiens} SCOP: g.43.1.1 | Back alignment and structure |
|---|
| >2csv_A Tripartite motif protein 29; ZF-B_BOX domain, TRIM29, ataxia-telangiectasia group D-associated protein, ATDC, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 | Back alignment and structure |
|---|
| >2dja_A Midline-2; tripartite motif protein 1, ZF-B_BOX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dq5_A | Back alignment and structure |
|---|
| >2yrg_A Tripartite motif-containing protein 5; B-box domain, ring finger protein 88, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2egm_A Tripartite motif-containing protein 41; ZF-B_BOX domain, tripartite motif protein 41, TRIM41, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fre_A Nuclear factor XNF7; zinc-binding protein, BBOX, development, MID-blastula- transition; NMR {Xenopus laevis} SCOP: g.43.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 77 | |||
| d2dq5a1 | 47 | Midline-1 {Human (Homo sapiens) [TaxId: 9606]} | 94.68 | |
| d2csva1 | 59 | Tripartite motif-containing protein 29 {Human (Hom | 94.61 | |
| d2djaa1 | 71 | Midline-2 {Human (Homo sapiens) [TaxId: 9606]} | 94.56 | |
| d2dida1 | 40 | Tripartite motif-containing protein 39 {Human (Hom | 94.11 | |
| d2d8ua1 | 51 | Ubiquitin ligase trim63 {Human (Homo sapiens) [Tax | 92.8 | |
| d1frea_ | 39 | Nuclear factor XNF7 {African clawed frog (Xenopus | 88.89 |
| >d2dq5a1 g.43.1.1 (A:168-214) Midline-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: B-box zinc-binding domain superfamily: B-box zinc-binding domain family: B-box zinc-binding domain domain: Midline-1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=94.68 E-value=0.0062 Score=32.93 Aligned_cols=28 Identities=32% Similarity=0.395 Sum_probs=23.6
Q ss_pred ceEEeecCCCCCCeeeehhhHHh-hcCCCceEE
Q psy6684 41 DFYRCQTCHTTDRNAICVNCIKS-CHAGHDVAF 72 (77)
Q Consensus 41 ~~Y~C~TC~~~d~~giC~~Ca~~-CH~GHdv~y 72 (77)
--|.|.||.. .||..|+.. =|+||++.-
T Consensus 16 l~~yC~~C~~----~iC~~C~~~~~H~~H~~~~ 44 (47)
T d2dq5a1 16 VNMYCVTDDQ----LICALCKLVGRHRDHQVAA 44 (47)
T ss_dssp EEEEETTTTE----EEEHHHHHTSSTTSSCCCC
T ss_pred ceEEcCCCCc----cCCccCcCcCCcCCCeEee
Confidence 4689999997 899999865 599999864
|
| >d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djaa1 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ua1 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|