Diaphorina citri psyllid: psy6686


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIGVAKVV
cHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHc
*WDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGL*HGAEQAPFYKLMTDVIKVGCKVAIGVAKVV
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIGVAKVV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquinone biosynthesis protein COQ7 homolog (Fragment) Involved in lifespan determination in ubiquinone-independent manner. Involved in ubiquinone biosynthesis. Potential central metabolic regulator.confidentQ63619
Ubiquinone biosynthesis protein COQ7 homolog Potential central metabolic regulator.confidentQ54VB3
Ubiquinone biosynthesis protein coq7 Involved in one or more monooxygenase steps of ubiquinone biosynthesis.confidentO74826

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0070584 [BP]mitochondrion morphogenesisprobableGO:0006996, GO:0032502, GO:0009987, GO:0032990, GO:0048869, GO:0071840, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0044699, GO:0008150, GO:0009653, GO:0007005
GO:0001306 [BP]age-dependent response to oxidative stressprobableGO:0032502, GO:0007571, GO:0007568, GO:0050896, GO:0044767, GO:0006950, GO:0008150, GO:0006979, GO:0044699
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0046914 [MF]transition metal ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0001841 [BP]neural tube formationprobableGO:0048598, GO:0016331, GO:0035148, GO:0009790, GO:0072175, GO:0009792, GO:0035239, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0043009, GO:0048646, GO:0032502, GO:0032501, GO:0021915, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0001838, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0000975 [MF]regulatory region DNA bindingprobableGO:0097159, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0034599 [BP]cellular response to oxidative stressprobableGO:0051716, GO:0033554, GO:0050896, GO:0009987, GO:0008150, GO:0006950, GO:0044763, GO:0070887, GO:0042221, GO:0006979, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0016491 [MF]oxidoreductase activityprobableGO:0003824, GO:0003674
GO:0001701 [BP]in utero embryonic developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006744 [BP]ubiquinone biosynthetic processprobableGO:0006732, GO:0006733, GO:0044249, GO:0009108, GO:0044281, GO:0044283, GO:0045426, GO:1901576, GO:0044710, GO:0051186, GO:1901663, GO:0051188, GO:1901661, GO:0042375, GO:0071704, GO:0006743, GO:0009987, GO:0009058, GO:0044711, GO:0008150, GO:0008152, GO:0042181, GO:0042180, GO:0044237
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0042775 [BP]mitochondrial ATP synthesis coupled electron transportprobableGO:0044710, GO:0009987, GO:0015980, GO:0016310, GO:0006793, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042773, GO:0055114, GO:0006119

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VJX, chain A
Confidence level:confident
Coverage over the Query: 1-99
View the alignment between query and template
View the model in PyMOL