Psyllid ID: psy6686

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIGVAKVV
cHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHc
cHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccc
MWDQEKAHKAKFEELIRKYRvrptallpfwnVAGFVLGagsallgpkgamACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEeqehhdtglehgaeqapfYKLMTDVIKVGCKVAIGVAKVV
mwdqekahKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIGVAKVV
MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIGVAKVV
***********FEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMS*******LMDVIH*******************QAPFYKLMTDVIKVGCKVAIGVA***
*WDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGL*HGAEQAPFYKLMTDVIKVGCKVAIGVAKVV
********KAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIGVAKVV
MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIGVAKVV
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIGVAKVV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
Q2TBW2217 Ubiquinone biosynthesis p no N/A 0.954 0.576 0.650 2e-42
P97478217 Ubiquinone biosynthesis p yes N/A 0.954 0.576 0.634 2e-42
Q99807217 Ubiquinone biosynthesis p no N/A 0.954 0.576 0.619 2e-41
Q63619179 Ubiquinone biosynthesis p yes N/A 0.954 0.698 0.626 5e-41
Q54VB3217 Ubiquinone biosynthesis p yes N/A 1.0 0.603 0.564 2e-35
O74826216 Ubiquinone biosynthesis p yes N/A 0.984 0.597 0.518 2e-31
P48376187 Ubiquinone biosynthesis p yes N/A 1.0 0.700 0.477 2e-31
P41735233 Catabolite repression pro yes N/A 1.0 0.562 0.426 1e-25
Q47IC7207 2-nonaprenyl-3-methyl-6-m yes N/A 0.923 0.584 0.301 8e-07
C1DHY3215 2-nonaprenyl-3-methyl-6-m yes N/A 0.893 0.544 0.295 1e-06
>sp|Q2TBW2|COQ7_BOVIN Ubiquinone biosynthesis protein COQ7 homolog OS=Bos taurus GN=COQ7 PE=2 SV=1 Back     alignment and function desciption
 Score =  170 bits (431), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 93/126 (73%), Gaps = 1/126 (0%)

Query: 1   MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVI 60
           MWDQEK H  KF EL+  +RVRPT L+PFWNV GF LGAG+ALLG +GAMACTVAVE  I
Sbjct: 86  MWDQEKDHLKKFNELMVAFRVRPTVLMPFWNVVGFALGAGTALLGKEGAMACTVAVEESI 145

Query: 61  VDHYNEQLRALM-SDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKV 119
             HYN Q+R LM  +P    EL+ VI KFRDEE EHHD GLEH AE AP Y ++  VI+ 
Sbjct: 146 AHHYNNQIRTLMEKEPEKYEELLQVIKKFRDEELEHHDIGLEHDAELAPAYVVLKSVIQA 205

Query: 120 GCKVAI 125
           GCKVAI
Sbjct: 206 GCKVAI 211
Involved in lifespan determination in ubiquinone-independent manner. Involved in ubiquinone biosynthesis. Potential central metabolic regulator.
Bos taurus (taxid: 9913)
>sp|P97478|COQ7_MOUSE Ubiquinone biosynthesis protein COQ7 homolog OS=Mus musculus GN=Coq7 PE=2 SV=3 Back     alignment and function description
>sp|Q99807|COQ7_HUMAN Ubiquinone biosynthesis protein COQ7 homolog OS=Homo sapiens GN=COQ7 PE=1 SV=3 Back     alignment and function description
>sp|Q63619|COQ7_RAT Ubiquinone biosynthesis protein COQ7 homolog (Fragment) OS=Rattus norvegicus GN=Coq7 PE=2 SV=3 Back     alignment and function description
>sp|Q54VB3|COQ7_DICDI Ubiquinone biosynthesis protein COQ7 homolog OS=Dictyostelium discoideum GN=coq7 PE=2 SV=1 Back     alignment and function description
>sp|O74826|COQ7_SCHPO Ubiquinone biosynthesis protein coq7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=coq7 PE=3 SV=1 Back     alignment and function description
>sp|P48376|COQ7_CAEEL Ubiquinone biosynthesis protein COQ7 homolog OS=Caenorhabditis elegans GN=clk-1 PE=1 SV=1 Back     alignment and function description
>sp|P41735|CAT5_YEAST Catabolite repression protein CAT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAT5 PE=1 SV=2 Back     alignment and function description
>sp|Q47IC7|COQ7_DECAR 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Dechloromonas aromatica (strain RCB) GN=coq7 PE=3 SV=1 Back     alignment and function description
>sp|C1DHY3|COQ7_AZOVD 2-nonaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=coq7 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
189014524189 ubiquinone biosynthesis protein [Gryllus 1.0 0.693 0.732 4e-54
189014534189 ubiquinone biosynthesis protein [Gryllus 1.0 0.693 0.732 4e-54
189014536189 ubiquinone biosynthesis protein [Gryllus 1.0 0.693 0.732 5e-54
119115340191 AGAP000118-PA [Anopheles gambiae str. PE 1.0 0.685 0.75 7e-54
350399177195 PREDICTED: ubiquinone biosynthesis prote 1.0 0.671 0.734 9e-54
189014554189 ubiquinone biosynthesis protein [Gryllus 1.0 0.693 0.725 1e-53
91083901191 PREDICTED: similar to ubiquinone biosynt 1.0 0.685 0.725 1e-53
340714447195 PREDICTED: ubiquinone biosynthesis prote 1.0 0.671 0.727 1e-53
242019928146 coenzyme q10 biosynthesis protein, putat 1.0 0.897 0.732 1e-53
322796526192 hypothetical protein SINV_01453 [Solenop 1.0 0.682 0.702 3e-53
>gi|189014524|gb|ACD69498.1| ubiquinone biosynthesis protein [Gryllus pennsylvanicus] gi|189014526|gb|ACD69499.1| ubiquinone biosynthesis protein [Gryllus pennsylvanicus] gi|189014528|gb|ACD69500.1| ubiquinone biosynthesis protein [Gryllus pennsylvanicus] gi|189014530|gb|ACD69501.1| ubiquinone biosynthesis protein [Gryllus pennsylvanicus] gi|189014532|gb|ACD69502.1| ubiquinone biosynthesis protein [Gryllus pennsylvanicus] gi|189014538|gb|ACD69505.1| ubiquinone biosynthesis protein [Gryllus pennsylvanicus] gi|189014540|gb|ACD69506.1| ubiquinone biosynthesis protein [Gryllus pennsylvanicus] gi|189014542|gb|ACD69507.1| ubiquinone biosynthesis protein [Gryllus pennsylvanicus] gi|189014544|gb|ACD69508.1| ubiquinone biosynthesis protein [Gryllus pennsylvanicus] gi|189014546|gb|ACD69509.1| ubiquinone biosynthesis protein [Gryllus firmus] gi|189014548|gb|ACD69510.1| ubiquinone biosynthesis protein [Gryllus firmus] gi|189014550|gb|ACD69511.1| ubiquinone biosynthesis protein [Gryllus firmus] gi|189014552|gb|ACD69512.1| ubiquinone biosynthesis protein [Gryllus firmus] gi|189014556|gb|ACD69514.1| ubiquinone biosynthesis protein [Gryllus firmus] Back     alignment and taxonomy information
 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 112/131 (85%)

Query: 1   MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVI 60
           MWDQEK HKAKFEELI KYRVRPT L P WNVAGF+LGAGSALLGPK AMACTVAVESVI
Sbjct: 59  MWDQEKEHKAKFEELINKYRVRPTVLTPIWNVAGFMLGAGSALLGPKAAMACTVAVESVI 118

Query: 61  VDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVG 120
           V+HYN QLR LMSDP  NREL+ V+ KFRD+EQEHHD GL+ GAE+ PFY+  +++IK+G
Sbjct: 119 VEHYNNQLRVLMSDPEKNRELLTVLQKFRDDEQEHHDKGLDEGAEETPFYEAFSNIIKLG 178

Query: 121 CKVAIGVAKVV 131
           C+ AI +++VV
Sbjct: 179 CRAAISLSEVV 189

Source: Gryllus pennsylvanicus

Species: Gryllus pennsylvanicus

Genus: Gryllus

Family: Gryllidae

Order: Orthoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189014534|gb|ACD69503.1| ubiquinone biosynthesis protein [Gryllus pennsylvanicus] Back     alignment and taxonomy information
>gi|189014536|gb|ACD69504.1| ubiquinone biosynthesis protein [Gryllus pennsylvanicus] Back     alignment and taxonomy information
>gi|119115340|ref|XP_311027.3| AGAP000118-PA [Anopheles gambiae str. PEST] gi|116130788|gb|EAA06356.4| AGAP000118-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|350399177|ref|XP_003485443.1| PREDICTED: ubiquinone biosynthesis protein COQ7 homolog [Bombus impatiens] Back     alignment and taxonomy information
>gi|189014554|gb|ACD69513.1| ubiquinone biosynthesis protein [Gryllus firmus] Back     alignment and taxonomy information
>gi|91083901|ref|XP_974528.1| PREDICTED: similar to ubiquinone biosynthesis protein COQ7-like protein [Tribolium castaneum] gi|270007952|gb|EFA04400.1| hypothetical protein TcasGA2_TC014699 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340714447|ref|XP_003395740.1| PREDICTED: ubiquinone biosynthesis protein COQ7 homolog [Bombus terrestris] Back     alignment and taxonomy information
>gi|242019928|ref|XP_002430410.1| coenzyme q10 biosynthesis protein, putative [Pediculus humanus corporis] gi|212515540|gb|EEB17672.1| coenzyme q10 biosynthesis protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322796526|gb|EFZ19000.1| hypothetical protein SINV_01453 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
FB|FBgn0029502219 COQ7 "COQ7" [Drosophila melano 1.0 0.598 0.664 4.2e-47
UNIPROTKB|Q2TBW2217 COQ7 "Ubiquinone biosynthesis 0.954 0.576 0.650 5.3e-40
UNIPROTKB|Q58CW1179 COQ7 "COQ7 protein" [Bos tauru 0.954 0.698 0.650 5.3e-40
UNIPROTKB|F1NIP2202 COQ7 "Uncharacterized protein" 0.954 0.618 0.643 8.7e-40
MGI|MGI:107207217 Coq7 "demethyl-Q 7" [Mus muscu 0.954 0.576 0.634 2.3e-39
UNIPROTKB|E2RF61217 COQ7 "Uncharacterized protein" 0.954 0.576 0.626 2.9e-39
UNIPROTKB|H3BP28194 COQ7 "Ubiquinone biosynthesis 0.954 0.644 0.619 9.9e-39
UNIPROTKB|Q99807217 COQ7 "Ubiquinone biosynthesis 0.954 0.576 0.619 9.9e-39
RGD|2381179 Coq7 "coenzyme Q7 homolog, ubi 0.954 0.698 0.626 2.6e-38
UNIPROTKB|Q63619179 Coq7 "Ubiquinone biosynthesis 0.954 0.698 0.626 2.6e-38
FB|FBgn0029502 COQ7 "COQ7" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 493 (178.6 bits), Expect = 4.2e-47, P = 4.2e-47
 Identities = 87/131 (66%), Positives = 111/131 (84%)

Query:     1 MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVI 60
             MW+QEK H+ +FE+LI+++RVRPT + P WNVAGFVLGAG+AL+G K AMACTVAVE+VI
Sbjct:    89 MWEQEKEHRKQFEQLIQQHRVRPTIMTPIWNVAGFVLGAGTALMGEKAAMACTVAVETVI 148

Query:    61 VDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVG 120
             V+HYN+QLR +M  P  ++EL+  I KFRDEEQEHHDTG++HGAEQAPFY+ MT+VIK G
Sbjct:   149 VEHYNDQLRQIMEAPNPDKELLATITKFRDEEQEHHDTGIDHGAEQAPFYQAMTEVIKFG 208

Query:   121 CKVAIGVAKVV 131
             CK AI ++K +
Sbjct:   209 CKTAIAISKKI 219
GO:0005739 "mitochondrion" evidence=ISS
GO:0006744 "ubiquinone biosynthetic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0046914 "transition metal ion binding" evidence=IEA
UNIPROTKB|Q2TBW2 COQ7 "Ubiquinone biosynthesis protein COQ7 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q58CW1 COQ7 "COQ7 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIP2 COQ7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:107207 Coq7 "demethyl-Q 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RF61 COQ7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H3BP28 COQ7 "Ubiquinone biosynthesis protein COQ7 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q99807 COQ7 "Ubiquinone biosynthesis protein COQ7 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|2381 Coq7 "coenzyme Q7 homolog, ubiquinone (yeast)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q63619 Coq7 "Ubiquinone biosynthesis protein COQ7 homolog" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P97478COQ7_MOUSENo assigned EC number0.63490.95410.5760yesN/A
Q63619COQ7_RATNo assigned EC number0.62690.95410.6983yesN/A
P48376COQ7_CAEELNo assigned EC number0.47721.00.7005yesN/A
O74826COQ7_SCHPONo assigned EC number0.51870.98470.5972yesN/A
Q54VB3COQ7_DICDINo assigned EC number0.56481.00.6036yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
pfam03232170 pfam03232, COQ7, Ubiquinone biosynthesis protein C 6e-77
cd01042165 cd01042, DMQH, Demethoxyubiquinone hydroxylase, fe 1e-59
COG2941204 COG2941, CAT5, Ubiquinone biosynthesis protein COQ 7e-42
cd00657130 cd00657, Ferritin_like, Ferritin-like superfamily 4e-05
>gnl|CDD|217441 pfam03232, COQ7, Ubiquinone biosynthesis protein COQ7 Back     alignment and domain information 
 Score =  224 bits (574), Expect = 6e-77
 Identities = 80/131 (61%), Positives = 97/131 (74%), Gaps = 1/131 (0%)

Query: 1   MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVI 60
           MWDQEK H A F ELI + RVRPT LLP W+VAGF LGAG+ALLG K AMACT AVE+VI
Sbjct: 41  MWDQEKVHLATFNELILERRVRPTLLLPLWHVAGFALGAGTALLGKKAAMACTAAVETVI 100

Query: 61  VDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVG 120
            +HYN+QLR L      ++EL + I KFRDEE EH DT +EHGAEQAP Y L++  IK G
Sbjct: 101 DEHYNDQLRELEELD-DDKELKETIAKFRDEELEHRDTAIEHGAEQAPAYPLLSGAIKAG 159

Query: 121 CKVAIGVAKVV 131
           C+ AI +++ +
Sbjct: 160 CRAAIALSERI 170

Members of this family contain two repeats of about 90 amino acids, that contains two conserved motifs. One of these DXEXXH may be part of an enzyme active site. Length = 170
>gnl|CDD|153101 cd01042, DMQH, Demethoxyubiquinone hydroxylase, ferritin-like diiron-binding domain Back     alignment and domain information
>gnl|CDD|225492 COG2941, CAT5, Ubiquinone biosynthesis protein COQ7 [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|153097 cd00657, Ferritin_like, Ferritin-like superfamily of diiron-containing four-helix-bundle proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
PF03232172 COQ7: Ubiquinone biosynthesis protein COQ7; InterP 100.0
KOG4061|consensus217 100.0
cd01042165 DMQH Demethoxyubiquinone hydroxylase, ferritin-lik 100.0
COG2941204 CAT5 Ubiquinone biosynthesis protein COQ7 [Coenzym 100.0
cd00657130 Ferritin_like Ferritin-like superfamily of diiron- 98.18
cd01045139 Ferritin_like_AB Uncharacterized family of ferriti 97.85
cd07908154 Mn_catalase_like Manganese catalase-like protein, 97.54
cd01052148 DPSL DPS-like protein, ferritin-like diiron-bindin 97.43
cd01044125 Ferritin_CCC1_N Ferritin-CCC1, N-terminal ferritin 97.41
cd01053168 AOX Alternative oxidase, ferritin-like diiron-bind 97.36
PRK10635158 bacterioferritin; Provisional 97.23
PF01786207 AOX: Alternative oxidase; InterPro: IPR002680 The 97.2
PLN02478328 alternative oxidase 96.86
cd00907153 Bacterioferritin Bacterioferritin, ferritin-like d 96.53
PF02915137 Rubrerythrin: Rubrerythrin; InterPro: IPR003251 Ru 96.53
cd01051156 Mn_catalase Manganese catalase, ferritin-like diir 96.38
PF00210142 Ferritin: Ferritin-like domain; InterPro: IPR00833 96.3
TIGR00754157 bfr bacterioferritin. Bacterioferritin is a homomu 95.91
cd01048135 Ferritin_like_AB2 Uncharacterized family of ferrit 95.79
COG1633176 Uncharacterized conserved protein [Function unknow 95.69
PF13668137 Ferritin_2: Ferritin-like domain 95.59
PRK13456186 DNA protection protein DPS; Provisional 94.64
cd01041134 Rubrerythrin Rubrerythrin, ferritin-like diiron-bi 94.08
cd01055156 Nonheme_Ferritin nonheme-containing ferritins. Non 93.34
cd01042165 DMQH Demethoxyubiquinone hydroxylase, ferritin-lik 93.2
PF03232172 COQ7: Ubiquinone biosynthesis protein COQ7; InterP 91.26
PF10118253 Metal_hydrol: Predicted metal-dependent hydrolase; 90.69
TIGR02284139 conserved hypothetical protein. Members of this pr 90.54
cd01056161 Euk_Ferritin eukaryotic ferritins. Eukaryotic Ferr 89.52
cd01043139 DPS DPS protein, ferritin-like diiron-binding doma 89.16
PF04305253 DUF455: Protein of unknown function (DUF455); Inte 88.7
PF14518106 Haem_oxygenas_2: Iron-containing redox enzyme; PDB 86.66
PF13668137 Ferritin_2: Ferritin-like domain 86.3
PRK10304165 ferritin; Provisional 86.18
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 82.96
cd01045139 Ferritin_like_AB Uncharacterized family of ferriti 81.63
PF11583304 AurF: P-aminobenzoate N-oxygenase AurF; PDB: 3CHI_ 81.06
COG2976207 Uncharacterized protein conserved in bacteria [Fun 80.15
>PF03232 COQ7: Ubiquinone biosynthesis protein COQ7; InterPro: IPR011566 Coq7 (also known as Clk-1) is a di-iron carboxylate protein occuring in both prokaryotes and eukaryotes that is essential for ubiquinone biosynthesis [, ] Back     alignment and domain information 
Probab=100.00  E-value=7.2e-55  Score=333.11  Aligned_cols=131  Identities=55%  Similarity=0.874  Sum_probs=126.8

Q ss_pred             ChhHHHHHHHHHHHHHHhcCCCCccchhHHHHHHHHHHHHhhhcCchhHHHHHHHHHHHHHHHHHHHHHHhcCC-ChhcH
Q psy6686           1 MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSD-PAANR   79 (131)
Q Consensus         1 m~~~E~~Hl~~f~~~l~~~~~RpS~L~PlW~~~gf~LGa~tal~G~~~~~a~t~avE~~V~~Hy~~ql~~L~~~-~~~~~   79 (131)
                      ||++|.+|++||+++|+++|+|||+|+|+|+++||+||++||++|++++|+||+|||++|++|||+||++|++. +..++
T Consensus        41 ~~~~E~~Hl~~f~~~l~~~~~RpS~l~Plw~~~g~~LG~~tal~G~~~~~a~t~avE~~V~~Hy~~Ql~~L~~~~~~~d~  120 (172)
T PF03232_consen   41 MAEEEKDHLAWFEQLLPELRVRPSLLNPLWYVAGFALGALTALLGDKAAMACTAAVETVVEEHYNDQLRELPAMGEEEDP  120 (172)
T ss_pred             HHHHHHHHHHHHHHHhHHcCCCCcHHHHHHHHHHHHHHHHHHhhchHHHHHHHHHHHHHHHHHHHHHHHHHHhccccchH
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999954 24688


Q ss_pred             HHHHHHHHHHHHHHhHHHhhHhCCCCCChhHHHHHHHHHHHHHHHHHHHhcC
Q psy6686          80 ELMDVIHKFRDEEQEHHDTGLEHGAEQAPFYKLMTDVIKVGCKVAIGVAKVV  131 (131)
Q Consensus        80 ~l~~~i~~~r~dE~~H~d~A~~~ga~~~p~~~~~~~~ik~~~~~ai~la~ri  131 (131)
                      +++++|++||+||.+|+|+|+++|++++|+|++|+++||+||++|||+|+||
T Consensus       121 ~l~~~i~~~r~DE~~H~d~A~~~~a~~~p~~~~l~~~i~~~~~~ai~~a~ri  172 (172)
T PF03232_consen  121 ELRAIIEQFRDDELEHRDTAIEAGAEKAPAYRLLSAVIKAGCKAAIWLAKRI  172 (172)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCcCcHHHHHHHHHHHHHHHHHHHHhcC
Confidence            9999999999999999999999999999999999999999999999999997

It has been implicated in the aging process as mutations in the Caenorhabditis elegans gene lead to increased lifespan []. Coq7 is a membrane-bound protein that functions as a monooxygenase to hydroxylate demethoxyubiquinone (2-methoxy-5-methyl-6-polyprenyl-1,4-benzoquinone) in the penultimate step of ubiquinone biosynthesis []. Biochemical studies indicate that NADH can serve directly as a reductant for catalytic activation of dioxygen and substrate oxidation by the enzyme, with no requirement for an additional reductase protein component []. This direct reaction with NADH is so far unique amongst members of the di-iron carboxylate protein family. This entry is specific for the bacterial Coq7 proteins.; GO: 0006744 ubiquinone biosynthetic process, 0055114 oxidation-reduction process
>KOG4061|consensus Back     alignment and domain information
>cd01042 DMQH Demethoxyubiquinone hydroxylase, ferritin-like diiron-binding domain Back     alignment and domain information
>COG2941 CAT5 Ubiquinone biosynthesis protein COQ7 [Coenzyme metabolism] Back     alignment and domain information
>cd00657 Ferritin_like Ferritin-like superfamily of diiron-containing four-helix-bundle proteins Back     alignment and domain information
>cd01045 Ferritin_like_AB Uncharacterized family of ferritin-like proteins found in archaea and bacteria Back     alignment and domain information
>cd07908 Mn_catalase_like Manganese catalase-like protein, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01052 DPSL DPS-like protein, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01044 Ferritin_CCC1_N Ferritin-CCC1, N-terminal ferritin-like diiron-binding domain Back     alignment and domain information
>cd01053 AOX Alternative oxidase, ferritin-like diiron-binding domain Back     alignment and domain information
>PRK10635 bacterioferritin; Provisional Back     alignment and domain information
>PF01786 AOX: Alternative oxidase; InterPro: IPR002680 The alternative oxidase is used as a second terminal oxidase in the mitochondria, electrons are transferred directly from reduced ubiquinol to oxygen forming water [] Back     alignment and domain information
>PLN02478 alternative oxidase Back     alignment and domain information
>cd00907 Bacterioferritin Bacterioferritin, ferritin-like diiron-binding domain Back     alignment and domain information
>PF02915 Rubrerythrin: Rubrerythrin; InterPro: IPR003251 Rubrerythrin (Rr), found in anaerobic sulphate-reducing bacteria [], is a fusion protein containing an N-terminal diiron-binding domain and a C-terminal domain homologous to rubredoxin [] Back     alignment and domain information
>cd01051 Mn_catalase Manganese catalase, ferritin-like diiron-binding domain Back     alignment and domain information
>PF00210 Ferritin: Ferritin-like domain; InterPro: IPR008331 Ferritin is one of the major non-haem iron storage proteins in animals, plants, and microorganisms [] Back     alignment and domain information
>TIGR00754 bfr bacterioferritin Back     alignment and domain information
>cd01048 Ferritin_like_AB2 Uncharacterized family of ferritin-like proteins found in archaea and bacteria Back     alignment and domain information
>COG1633 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13668 Ferritin_2: Ferritin-like domain Back     alignment and domain information
>PRK13456 DNA protection protein DPS; Provisional Back     alignment and domain information
>cd01041 Rubrerythrin Rubrerythrin, ferritin-like diiron-binding domain Back     alignment and domain information
>cd01055 Nonheme_Ferritin nonheme-containing ferritins Back     alignment and domain information
>cd01042 DMQH Demethoxyubiquinone hydroxylase, ferritin-like diiron-binding domain Back     alignment and domain information
>PF03232 COQ7: Ubiquinone biosynthesis protein COQ7; InterPro: IPR011566 Coq7 (also known as Clk-1) is a di-iron carboxylate protein occuring in both prokaryotes and eukaryotes that is essential for ubiquinone biosynthesis [, ] Back     alignment and domain information
>PF10118 Metal_hydrol: Predicted metal-dependent hydrolase; InterPro: IPR016516 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>TIGR02284 conserved hypothetical protein Back     alignment and domain information
>cd01056 Euk_Ferritin eukaryotic ferritins Back     alignment and domain information
>cd01043 DPS DPS protein, ferritin-like diiron-binding domain Back     alignment and domain information
>PF04305 DUF455: Protein of unknown function (DUF455); InterPro: IPR007402 This is a family of uncharacterised proteins Back     alignment and domain information
>PF14518 Haem_oxygenas_2: Iron-containing redox enzyme; PDB: 3BJD_B Back     alignment and domain information
>PF13668 Ferritin_2: Ferritin-like domain Back     alignment and domain information
>PRK10304 ferritin; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>cd01045 Ferritin_like_AB Uncharacterized family of ferritin-like proteins found in archaea and bacteria Back     alignment and domain information
>PF11583 AurF: P-aminobenzoate N-oxygenase AurF; PDB: 3CHI_B 3CHT_A 3CHH_A 2JCD_B 3CHU_A Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
2qqy_A149 Sigma B operon; dodecameric alpha-helical, ferriti 97.67
2y3q_A158 Bacterioferritin; metal binding protein, redox; HE 97.21
3gvy_A161 Bacterioferritin; iron storage, DI-iron, ferroxida 96.91
4am5_A159 Bacterioferritin; metal binding protein, ferroxida 96.86
4etr_A153 Putative uncharacterized protein; DUF2383, domain 96.8
3uoi_A161 Bacterioferritin, BFR; structural genomics, TB str 96.76
2fkz_A155 Bacterioferritin; ferroxidase, DIIRON site, iron T 96.7
3fvb_A182 Bacterioferritin; niaid, ssgcid, decode, structura 96.56
1jgc_A161 Bacterioferritin, BFR; iron storage protein, metal 96.49
3r2k_A154 Bacterioferritin, BFR; bacterial ferritin, iron bi 96.47
3qb9_A174 Bacterioferritin, BFR; cytosol, structural genomic 96.41
2vzb_A170 Putative bacterioferritin-related protein; DPS, DP 96.27
1nfv_A179 Bacterioferritin; 24 subunits in the active molecu 96.22
1ji5_A142 DLP-1; dodecamer, four-helix bundle, metal transpo 96.04
2vxx_A192 Starvation induced DNA binding protein; stress res 95.74
1jig_A146 DLP-2; dodecamer, four-helix bundle, metal transpo 95.53
1n1q_A149 DPS protein; four-helix bundle, unknown function; 95.5
2fzf_A175 Hypothetical protein; structural genomics, southea 94.81
1eum_A165 Ferritin 1; ECFTNA, metal binding protein; 2.05A { 94.77
2jd6_0174 Ferritin homolog, ferritin; metal transport, iron, 94.71
1krq_A167 Ferritin; H-chain like four-helix bundle, binding 94.27
1vjx_A157 Putative ferritin-like DIIRON-carboxylate protein; 94.17
3oj5_A189 Ferritin family protein; ferroxidase, cytosol, oxi 94.12
2d5k_A156 DPS, DPS family protein; four helix bundle, metal 94.0
3uno_A189 Probable bacterioferritin BFRB; ferroxidase activi 93.85
3qz3_A184 Ferritin; structural genomics, the center for stru 93.82
2v8t_A302 Manganese-containing pseudocatalase; manganese cat 93.78
1rcd_A173 L ferritin; iron storage; 2.00A {Rana catesbeiana} 93.77
1s3q_A173 Ferritin; ferroxidase, four helix bundle, iron sto 93.52
2oh3_A167 Rubrerythrin, COG1633: uncharacterized conserved p 93.4
2c41_A158 DPS family DNA-binding stress response protein; ir 93.36
1j30_A144 144AA long hypothetical rubrerythrin; sulerythrin, 93.31
2v2p_A174 Ferritin light chain; metal transport, iron, haemi 93.17
1o9i_A266 Pseudocatalase; oxidoreductase, hexamer, dimangane 92.69
2clb_A188 DPS-like protein; DI-iron carboxylate, hypothetica 92.43
1tjo_A182 Iron-rich DPSA-homolog protein; ferritin, low-iron 92.29
2cih_A183 Ferritin heavy chain; apoferritin, ferroxidase, DI 91.91
3bvf_A181 Ferritin; iron storage, metal-binding, oxidoreduct 91.71
3e6s_A168 Ferritin; iron storage, ferroxidase, oxidoreductas 91.42
1vlg_A176 Ferritin; TM1128, structural genomics, JCSG, prote 91.2
3a68_A212 Sferh-4, ferritin-4, chloroplastic; 4-helix bundle 90.46
1o9r_A162 Agrobacterium tumefaciens DPS; iron-binding protei 90.38
3ka8_A176 Ferritin, middle subunit; iron storage, DIIRON, ir 90.35
2bk6_A156 Non-heme iron-containing ferritin; DPS (DNA bindin 89.13
2yw6_A183 DNA protection during starvation protein; DNA-bind 88.66
2yjk_A161 AFP, DPS; metal-binding protein, iron uptake, ferr 88.66
2fjc_A156 Antigen TPF1; mini ferritin, iron binding protein, 88.49
2c2j_A211 DNA-binding stress response protein; DNA-binding p 88.49
2chp_A153 MRGA, metalloregulation DNA-binding stress protein 88.43
2wlu_A175 DPS-like peroxide resistance protein; DNA-binding, 88.37
3vnx_A204 Ferritin; 4-helix bundle, iron storage, oxidoreduc 88.34
3k6c_A95 Uncharacterized protein NE0167; structural genomic 87.63
3kxu_A191 Ferritin; iron storage protein, disorder, iron, me 87.47
2xgw_A199 Peroxide resistance protein; metal binding protein 87.41
2cf7_A165 DPR; peroxide resistance, DPS-family, ferritin-lik 87.0
2z90_A161 Starvation-inducible DNA-binding protein or FINE t 86.29
2c2u_A207 DPS, DNA-binding stress response protein; DNA-bind 86.24
3ak8_A167 DNA protection during starvation protein; DPS-like 85.63
3kwo_A152 Putative bacterioferritin; alpha-helix, bacterial 85.29
4eve_A164 Neutrophil-activating protein; dodecamer, four-hel 83.66
3iq1_A159 DPS family protein; csgid, SAD, niaid, metal trans 82.66
1jm0_A50 Protein (four-helix bundle model); alpha-helical b 80.51
>2qqy_A Sigma B operon; dodecameric alpha-helical, ferritin fold, structural genomic protein structure initiative; 2.00A {Bacillus anthracis str} Back     alignment and structure
Probab=97.67  E-value=0.00023  Score=49.68  Aligned_cols=87  Identities=15%  Similarity=0.179  Sum_probs=68.0

Q ss_pred             hhHHHHHHHHHHHHHHhcCCCCccchhHHHHHHHHHHHHhhhcCchhHHHHHHHHHHHHHHHHHHHHHHhcCCChhcHHH
Q psy6686           2 WDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAGSALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAANREL   81 (131)
Q Consensus         2 ~~~E~~Hl~~f~~~l~~~~~RpS~L~PlW~~~gf~LGa~tal~G~~~~~a~t~avE~~V~~Hy~~ql~~L~~~~~~~~~l   81 (131)
                      .++|.+|...|.+++..+|.+|+. .|-         -.....+....+....+-|+.+...|++.++.-...  +|..+
T Consensus        52 a~ee~~Ha~~l~e~i~~lgg~p~~-~~~---------~~~~~~~~~e~l~~~l~~E~~~~~~~~~~~~~a~~~--~D~~t  119 (149)
T 2qqy_A           52 ISDEQGHALYLAEKIKTLGGTPTT-IPL---------RVKQAEDVREMLEYARQSEYETIKRYEKRKEQAANL--NMTEL  119 (149)
T ss_dssp             HHHHHHHHHHHHHHHHHTTCCCCC-CCC---------CCCCCSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHT--TCHHH
T ss_pred             HHHHHHHHHHHHHHHHHcCCccCC-CCC---------CCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHC--CCHHH
Confidence            368999999999999999999988 531         112223556778888899999999999988765322  46777


Q ss_pred             HHHHHHHHHHHHhHHHhhH
Q psy6686          82 MDVIHKFRDEEQEHHDTGL  100 (131)
Q Consensus        82 ~~~i~~~r~dE~~H~d~A~  100 (131)
                      ++.|+.+..||.+|...-.
T Consensus       120 ~~~l~~~~~eee~h~~~l~  138 (149)
T 2qqy_A          120 VVKLEDMIADETNHMEELD  138 (149)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            8889999999999987643
>2y3q_A Bacterioferritin; metal binding protein, redox; HET: HEM; 1.55A {Escherichia coli} PDB: 1bfr_A* 1bcf_A* 2htn_A* 2vxi_A* 3e1j_A* 3e1l_A* 3e1m_A* 3e1n_A* 3e1o_A* 3e1p_A* 3ghq_A* 3e1q_A* 3e2c_A* 3isf_A* 3is8_A* 3ise_A* 3is7_A* Back     alignment and structure
>3gvy_A Bacterioferritin; iron storage, DI-iron, ferroxida activity, heme, metal binding protein; HET: HEM; 2.80A {Rhodobacter sphaeroides} SCOP: a.25.1.1 Back     alignment and structure
>4am5_A Bacterioferritin; metal binding protein, ferroxidase centre, iron storage, DI centre, iron channel, heme binding; HET: HEM; 1.58A {Blastochloris viridis} PDB: 4am2_A* 4am4_A* Back     alignment and structure
>4etr_A Putative uncharacterized protein; DUF2383, domain of unknown function, cytoplasmic, unknown FU; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3uoi_A Bacterioferritin, BFR; structural genomics, TB structural genomics consortium, TBSG ferroxidation and iron storage, cytosol; HET: HEM; 1.90A {Mycobacterium tuberculosis} PDB: 3uof_A* 3qb9_A* 2wtl_A* 3bkn_A* Back     alignment and structure
>2fkz_A Bacterioferritin; ferroxidase, DIIRON site, iron T metal binding protein; HET: HEM; 2.00A {Azotobacter vinelandii} SCOP: a.25.1.1 PDB: 2fl0_A* 1sof_A* Back     alignment and structure
>3fvb_A Bacterioferritin; niaid, ssgcid, decode, structural genomics, seattle structural genomics center for infectious disease; HET: HEM; 1.81A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>1jgc_A Bacterioferritin, BFR; iron storage protein, metal binding protein; HET: HEM; 2.60A {Rhodobacter capsulatus} SCOP: a.25.1.1 Back     alignment and structure
>3r2k_A Bacterioferritin, BFR; bacterial ferritin, iron binding, iron storage, iron homeost iron release, iron mobilization; 1.55A {Pseudomonas aeruginosa} SCOP: a.25.1.0 PDB: 3r2h_A 3r2l_A 3r2m_A 3r2o_A 3r2r_A 3r2s_A Back     alignment and structure
>3qb9_A Bacterioferritin, BFR; cytosol, structural genomics, TB structural genomics consort TBSGC, metal binding protein; HET: HEM; 2.11A {Mycobacterium tuberculosis} PDB: 2wtl_A* 3bkn_A* Back     alignment and structure
>2vzb_A Putative bacterioferritin-related protein; DPS, DPSL, iron, oxidative stress, metal transport; 2.30A {Bacteroides fragilis} Back     alignment and structure
>1nfv_A Bacterioferritin; 24 subunits in the active molecule, DIIRON HAEM Fe-coproporphyrin III cofactor, iron storage-electron complex; HET: FEC; 1.95A {Desulfovibrio desulfuricans} SCOP: a.25.1.1 PDB: 1nf6_A* 1nf4_A* Back     alignment and structure
>1ji5_A DLP-1; dodecamer, four-helix bundle, metal transport; 2.50A {Bacillus anthracis} SCOP: a.25.1.1 Back     alignment and structure
>2vxx_A Starvation induced DNA binding protein; stress response protein, DPS, oxidation, iron binding, ferroxidase centre; HET: PG4; 2.40A {Synechococcus elongatus} Back     alignment and structure
>1jig_A DLP-2; dodecamer, four-helix bundle, metal transport; 1.46A {Bacillus anthracis} SCOP: a.25.1.1 Back     alignment and structure
>1n1q_A DPS protein; four-helix bundle, unknown function; 2.20A {Brevibacillus brevis} SCOP: a.25.1.1 Back     alignment and structure
>2fzf_A Hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative, PSI; 2.70A {Pyrococcus furiosus} SCOP: a.25.1.1 Back     alignment and structure
>1eum_A Ferritin 1; ECFTNA, metal binding protein; 2.05A {Escherichia coli} SCOP: a.25.1.1 Back     alignment and structure
>2jd6_0 Ferritin homolog, ferritin; metal transport, iron, pores, archaeon, entry channels, thermostability, hyperthermophIle, ferroxidase center; 2.75A {Pyrococcus furiosus} PDB: 2jd7_0 2jd8_0 2x17_0 Back     alignment and structure
>1krq_A Ferritin; H-chain like four-helix bundle, binding protein; 2.70A {Campylobacter jejuni} SCOP: a.25.1.1 Back     alignment and structure
>1vjx_A Putative ferritin-like DIIRON-carboxylate protein; structural genomics, joint center for structural genomics, J protein structure initiative; 2.30A {Thermotoga maritima} SCOP: a.25.1.1 Back     alignment and structure
>3oj5_A Ferritin family protein; ferroxidase, cytosol, oxidoreductase; 2.85A {Mycobacterium tuberculosis} PDB: 3qd8_A Back     alignment and structure
>2d5k_A DPS, DPS family protein; four helix bundle, metal binding protein; 1.85A {Staphylococcus aureus subsp} Back     alignment and structure
>3uno_A Probable bacterioferritin BFRB; ferroxidase activity, iron storage, oxidoreductase; 2.50A {Mycobacterium tuberculosis} PDB: 3oj5_A 3qd8_A Back     alignment and structure
>3qz3_A Ferritin; structural genomics, the center for structural genomics of I diseases, csgid, cytoplasmic, oxidoreductase; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: a.25.1.1 Back     alignment and structure
>2v8t_A Manganese-containing pseudocatalase; manganese catalase, oxidoreductase; 0.98A {Thermus thermophilus} PDB: 2v8u_A 2cwl_A Back     alignment and structure
>1rcd_A L ferritin; iron storage; 2.00A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 1rcg_A 1rci_A 1rcc_A 1rce_A Back     alignment and structure
>1s3q_A Ferritin; ferroxidase, four helix bundle, iron storage, metal binding; 2.10A {Archaeoglobus fulgidus} SCOP: a.25.1.1 PDB: 1sq3_A 3kx9_A Back     alignment and structure
>2oh3_A Rubrerythrin, COG1633: uncharacterized conserved protein; ZP_00055496.1, COG1633: uncharacterized conSer protein; HET: MSE PGE; 2.00A {Magnetospirillum magnetotacticum} SCOP: a.25.1.8 Back     alignment and structure
>2c41_A DPS family DNA-binding stress response protein; iron-binding/oxidation protein, DPS (DNA-binding proteins from starved cells); HET: PG4 PGE; 1.81A {Thermosynechococcus elongatus} Back     alignment and structure
>1j30_A 144AA long hypothetical rubrerythrin; sulerythrin, sulfolobus tokodaii strain 7, FOU bundle, domain swapping, metal binding site plasticity; 1.70A {Sulfolobus tokodaii} SCOP: a.25.1.1 Back     alignment and structure
>2v2p_A Ferritin light chain; metal transport, iron, haemin, apoferritin, iron storage, metal-binding; 1.15A {Equus caballus} PDB: 2v2r_A 2v2m_A 2v2l_A 2v2s_A 2v2o_A 2v2n_A 2za6_A 2v2j_A 2v2i_A 2z5p_A 1dat_A 2g4h_A 1aew_A 3h7g_A 2zg9_X 2zg8_X 3fi6_A 3o7r_A 2w0o_A 1hrs_A* ... Back     alignment and structure
>1o9i_A Pseudocatalase; oxidoreductase, hexamer, dimanganese catalase, metalloenzyme, preoxidase; HET: MES; 1.33A {Lactobacillus plantarum} SCOP: a.25.1.3 PDB: 1jkv_A 1jku_A Back     alignment and structure
>2clb_A DPS-like protein; DI-iron carboxylate, hypothetical protein, bacterioferritin, hydrogen peroxide, metal binding protein, archaea; 2.4A {Sulfolobus solfataricus} Back     alignment and structure
>1tjo_A Iron-rich DPSA-homolog protein; ferritin, low-iron, metal binding protein; 1.60A {Halobacterium salinarum} SCOP: a.25.1.1 PDB: 1moj_A 1tk6_A 1tko_A 1tkp_A Back     alignment and structure
>2cih_A Ferritin heavy chain; apoferritin, ferroxidase, DI-iron non-heme protein, iron storage, iron, metal-binding, oxidoreductase, phosphorylation; 1.5A {Homo sapiens} PDB: 2chi_A 2cei_A 1fha_A 2fha_A 2cn7_A 2iu2_A 2clu_A 2cn6_A 3ajo_A 3ajq_A 3ajp_A 3erz_A 3es3_A 2z6m_A 1r03_A Back     alignment and structure
>3e6s_A Ferritin; iron storage, ferroxidase, oxidoreductase; 1.95A {Pseudo-nitzschia multiseries} SCOP: a.25.1.1 PDB: 3e6r_A Back     alignment and structure
>1vlg_A Ferritin; TM1128, structural genomics, JCSG, protein structu initiative, PSI, joint center for structural genomics, META protein; 2.00A {Thermotoga maritima} SCOP: a.25.1.1 PDB: 1z4a_A* Back     alignment and structure
>3a68_A Sferh-4, ferritin-4, chloroplastic; 4-helix bundle, iron storage, CAGE-like protein, plant, iron, metal-binding, oxidoreductase, plastid; 1.80A {Glycine max} PDB: 3a9q_A Back     alignment and structure
>1o9r_A Agrobacterium tumefaciens DPS; iron-binding protein, DNA protection from oxidative damage, DNA-binding, iron- binding protein; 1.45A {Agrobacterium tumefaciens} SCOP: a.25.1.1 PDB: 3ge4_A* Back     alignment and structure
>3ka8_A Ferritin, middle subunit; iron storage, DIIRON, iron, metal-binding, oxidoreductase; 1.35A {Rana catesbeiana} SCOP: a.25.1.1 PDB: 3ka9_A 3ka3_A 1mfr_A 3ka4_A 3rbc_A 3re7_A 3rgd_A 4das_A* 3ka6_A 3shx_A 3sh6_A 3se1_A 1bg7_A Back     alignment and structure
>2bk6_A Non-heme iron-containing ferritin; DPS (DNA binding protein from starved cells), ferroxidase center, mutagenesis study; 2.19A {Listeria innocua} SCOP: a.25.1.1 PDB: 1qgh_A 2bjy_A 2iy4_A 2bkc_A Back     alignment and structure
>2yw6_A DNA protection during starvation protein; DNA-binding protein, quarternary assembly, ferroxidation, oxidoreductase; HET: DNA; 2.53A {Mycobacterium smegmatis} SCOP: a.25.1.1 PDB: 1vei_A 1vel_A 1veq_A 1uvh_A* 2yw7_A Back     alignment and structure
>2yjk_A AFP, DPS; metal-binding protein, iron uptake, ferritin fold; 2.00A {Microbacterium arborescens} PDB: 2yjj_A Back     alignment and structure
>2fjc_A Antigen TPF1; mini ferritin, iron binding protein, metal transport; 2.50A {Treponema pallidum} SCOP: a.25.1.1 Back     alignment and structure
>2c2j_A DNA-binding stress response protein; DNA-binding protein, DPS; 2.05A {Deinococcus radiodurans} PDB: 2c6r_A Back     alignment and structure
>2chp_A MRGA, metalloregulation DNA-binding stress protein; DNA-binding protein, DPS, dodecameric, ferritin; 2.0A {Bacillus subtilis} Back     alignment and structure
>2wlu_A DPS-like peroxide resistance protein; DNA-binding, oxidoreductase; 1.94A {Streptococcus pyogenes} PDB: 2wla_A Back     alignment and structure
>3vnx_A Ferritin; 4-helix bundle, iron storage, oxidoreductase; 2.40A {Ulva pertusa} Back     alignment and structure
>3k6c_A Uncharacterized protein NE0167; structural genomics, MCSG, unknown function protein, PSI, PR structure initiative; 2.20A {Nitrosomonas europaea} Back     alignment and structure
>3kxu_A Ferritin; iron storage protein, disorder, iron, metal binding protein; 1.85A {Homo sapiens} PDB: 3hx2_A 3hx5_A 3hx7_A Back     alignment and structure
>2xgw_A Peroxide resistance protein; metal binding protein; 2.10A {Streptococcus pyogenes} Back     alignment and structure
>2cf7_A DPR; peroxide resistance, DPS-family, ferritin-like, ferroxidase, iron-binding; HET: EPE; 1.50A {Streptococcus suis} PDB: 2ux1_A* 2bw1_A* 1umn_A* 2v15_A* 2xjm_A* 2xjn_A* 2xjo_A* 2xkq_A* Back     alignment and structure
>2z90_A Starvation-inducible DNA-binding protein or FINE tangled PILI major subunit; quarternary assembly, ferroxidation; 2.40A {Mycobacterium smegmatis str} Back     alignment and structure
>2c2u_A DPS, DNA-binding stress response protein; DNA-binding protein, iron; 1.1A {Deinococcus radiodurans} PDB: 2c2f_A 2f7n_A Back     alignment and structure
>3ak8_A DNA protection during starvation protein; DPS-like protein, dodecamer, iron-binding protein, metal BIN protein, oxidoreductase; HET: DNA; 1.25A {Salmonella enterica subsp} PDB: 3ak9_A* 1f33_A* 1f30_A* 1dps_A 1jts_A* 1jre_A* 1l8h_A* 1l8i_A* 4dyu_A* Back     alignment and structure
>3kwo_A Putative bacterioferritin; alpha-helix, bacterial ferritin fold, structural genomics, center for structural genomics of infectious diseases; 1.99A {Campylobacter jejuni} SCOP: a.25.1.0 Back     alignment and structure
>4eve_A Neutrophil-activating protein; dodecamer, four-helix bundle, metal transport; 2.10A {Helicobacter pylori} PDB: 4evd_A 3t9j_A 3ta8_A 4evb_A 4evc_A 1ji4_A Back     alignment and structure
>3iq1_A DPS family protein; csgid, SAD, niaid, metal transport, STRU genomics, center for structural genomics of infectious DISE; 1.67A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>1jm0_A Protein (four-helix bundle model); alpha-helical bundle, protein design, de novo protein; 1.70A {Synthetic} SCOP: k.8.1.1 PDB: 1jmb_A 1ovu_A 1ovv_A 1lt1_A 1ec5_A 1nvo_A 1ovr_A 2kik_A 1u7j_A 1y47_A 1mft_A 1u7m_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d2fzfa1158 a.25.1.1 (A:10-167) Hypothetical protein PF1190 {A 4e-10
>d2fzfa1 a.25.1.1 (A:10-167) Hypothetical protein PF1190 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 158 Back     information, alignment and structure

class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ferritin
domain: Hypothetical protein PF1190
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

 Score = 52.2 bits (124), Expect = 4e-10
 Identities = 14/101 (13%), Positives = 35/101 (34%), Gaps = 8/101 (7%)

Query: 1   MWDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGF---VLGAGSALLGPKGAMACTVAVE 57
           + ++EK H+A   +L  +       + P  ++      V      +      +   +  E
Sbjct: 49  LAEEEKKHEALLRKLYSQMFPGKEVVFPKEHIGPELQPVARELEKVQDIIDLIRWAMKAE 108

Query: 58  SVIVDHYNEQLRALMSDPAANRELMDVIHKFRDEEQEHHDT 98
            +  + Y +     + +     E   ++    D E+ H+ T
Sbjct: 109 EIAAEFYLK-----LEEMVKEEEKKRLMRYLADMERGHYYT 144

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d2fzfa1158 Hypothetical protein PF1190 {Archaeon Pyrococcus f 97.96
d2oh3a1152 Uncharacterized protein AMB4284 homologue {Magneto 97.24
d1vjxa_149 Hypothetical protein TM1526 {Thermotoga maritima [ 97.16
d1yuza1135 Nigerythrin, N-terminal domain {Desulfovibrio vulg 96.59
d2htna1158 Bacterioferritin (cytochrome b1) {Escherichia coli 96.38
d1nf4a_169 Bacterioferritin (cytochrome b1) {Desulfovibrio de 96.3
d2ib0a1142 Hypothetical protein Rv2844 {Mycobacterium tubercu 96.15
d1jgca_160 Bacterioferritin (cytochrome b1) {Rhodobacter caps 95.99
d1lkoa1146 Rubrerythrin, N-terminal domain {Desulfovibrio vul 95.91
d1j30a_141 Hypothetical rubrerythrin {Archaeon Sulfolobus tok 95.85
d2fkza1154 Bacterioferritin (cytochrome b1) {Azotobacter vine 95.72
d1euma_161 Non-hem ferritin {Escherichia coli, FtnA [TaxId: 5 91.92
d1vlga_164 Non-hem ferritin {Thermotoga maritima [TaxId: 2336 91.13
d1s3qa1162 Non-hem ferritin {Archaeon Archaeoglobus fulgidus 90.19
d1krqa_165 Non-hem ferritin {Campylobacter jejuni [TaxId: 197 90.16
d1nnqa1133 Rubrerythrin, N-terminal domain {Archaeon Pyrococc 87.42
d1zpya191 Hypothetical protein NE0167 {Nitrosomonas europaea 82.93
d1rcda_171 (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 82.68
d1jkva_266 Manganese catalase (T-catalase) {Lactobacillus pla 81.76
d2oh3a1152 Uncharacterized protein AMB4284 homologue {Magneto 81.0
d1o9ra_162 Dodecameric ferritin homolog {Agrobacterium tumefa 80.54
>d2fzfa1 a.25.1.1 (A:10-167) Hypothetical protein PF1190 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
class: All alpha proteins
fold: Ferritin-like
superfamily: Ferritin-like
family: Ferritin
domain: Hypothetical protein PF1190
species: Archaeon Pyrococcus furiosus [TaxId: 2261]

Probab=97.96  E-value=1.5e-06  Score=59.73  Aligned_cols=93  Identities=14%  Similarity=0.140  Sum_probs=73.0

Q ss_pred             hhHHHHHHHHHHHHHHhcCCCCccchhHHHHHHHHHHHH---hhhcCchhHHHHHHHHHHHHHHHHHHHHHHhcCCChhc
Q psy6686           2 WDQEKAHKAKFEELIRKYRVRPTALLPFWNVAGFVLGAG---SALLGPKGAMACTVAVESVIVDHYNEQLRALMSDPAAN   78 (131)
Q Consensus         2 ~~~E~~Hl~~f~~~l~~~~~RpS~L~PlW~~~gf~LGa~---tal~G~~~~~a~t~avE~~V~~Hy~~ql~~L~~~~~~~   78 (131)
                      -++|..|...|.+++.+++..|+...|.+...+......   ....+..-++.+....|......|+...+..     .+
T Consensus        50 a~eE~~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~E~~a~~~Y~~la~~~-----~d  124 (158)
T d2fzfa1          50 AEEEKKHEALLRKLYSQMFPGKEVVFPKEHIGPELQPVARELEKVQDIIDLIRWAMKAEEIAAEFYLKLEEMV-----KE  124 (158)
T ss_dssp             HHHTHHHHHHHHHHHHHHSTTCCCCCCSCCBSCCCCCCCSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHTS-----CS
T ss_pred             HHHHHHHHHHHHHHHHHhCCCccccchhhhhhhhhhhhHhhccccCCHHHHHHHHHHHHHHHHHHHHHHHHhc-----Cc
Confidence            478999999999999999999998887765554433322   2223455667777889999999999988765     36


Q ss_pred             HHHHHHHHHHHHHHHhHHHhh
Q psy6686          79 RELMDVIHKFRDEEQEHHDTG   99 (131)
Q Consensus        79 ~~l~~~i~~~r~dE~~H~d~A   99 (131)
                      +.+++.+.++.+||.+|...-
T Consensus       125 ~~~~~l~~~i~~~E~~H~~~l  145 (158)
T d2fzfa1         125 EEKKRLMRYLADMERGHYYTL  145 (158)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            788888999999999998654
>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]} Back     information, alignment and structure
>d1vjxa_ a.25.1.1 (A:) Hypothetical protein TM1526 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yuza1 a.25.1.1 (A:23-157) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2htna1 a.25.1.1 (A:1-158) Bacterioferritin (cytochrome b1) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nf4a_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d2ib0a1 a.25.1.9 (A:17-158) Hypothetical protein Rv2844 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jgca_ a.25.1.1 (A:) Bacterioferritin (cytochrome b1) {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1lkoa1 a.25.1.1 (A:2-147) Rubrerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1j30a_ a.25.1.1 (A:) Hypothetical rubrerythrin {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d2fkza1 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1euma_ a.25.1.1 (A:) Non-hem ferritin {Escherichia coli, FtnA [TaxId: 562]} Back     information, alignment and structure
>d1vlga_ a.25.1.1 (A:) Non-hem ferritin {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s3qa1 a.25.1.1 (A:3-164) Non-hem ferritin {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1krqa_ a.25.1.1 (A:) Non-hem ferritin {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1nnqa1 a.25.1.1 (A:2-134) Rubrerythrin, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zpya1 a.25.1.5 (A:4-94) Hypothetical protein NE0167 {Nitrosomonas europaea [TaxId: 915]} Back     information, alignment and structure
>d1rcda_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} Back     information, alignment and structure
>d1jkva_ a.25.1.3 (A:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2oh3a1 a.25.1.8 (A:3-154) Uncharacterized protein AMB4284 homologue {Magnetospirillum magnetotacticum ms-1 [TaxId: 272627]} Back     information, alignment and structure
>d1o9ra_ a.25.1.1 (A:) Dodecameric ferritin homolog {Agrobacterium tumefaciens, Dps [TaxId: 358]} Back     information, alignment and structure