Diaphorina citri psyllid: psy6687


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110------
MCQCPKGYQGTYCGTAMCFPQCLNNGTCTAPGVCSCPPGFQGLHCEGGPGPGCDQKCSNGGWCDSQQMCQCPKGYQGTYCGTAMCFPQCLNNGTCTAPGVCSCPPGFQGLHCEGGT
ccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccEEcccccEEcccccccccccccccccccccccEEcccccEEcccccccccccccc
MCQCPKGYQGTYCGTAMCFPQCLNNGTCTAPGVCSCPPGFQGLHCEGGPGPGCDQKCSNGGWCDSQQMCQCPKGYQGTYCGTAMCFPQCLNNGTCTAPGVCSCPPGFQGLHCEG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCQCPKGYQGTYCGTAMCFPQCLNNGTCTAPGVCSCPPGFQGLHCEGGPGPGCDQKCSNGGWCDSQQMCQCPKGYQGTYCGTAMCFPQCLNNGTCTAPGVCSCPPGFQGLHCEGGT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein shifted Required for normal accumulation and movement of lipid-modified hedgehog (hh) morphogen. May act by stabilizing the interaction between heparan sulfate proteoglycans (HSPGs) and hh, HSPGs being required for diffusion of hh morphogen. Not involved in wingless (wg) morphogen movement, suggesting that it may provide HSPG specificity for Hh.confidentQ9W3W5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005102 [MF]receptor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0048666 [BP]neuron developmentprobableGO:0032502, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0048468, GO:0044767, GO:0032501, GO:0044763, GO:0048731, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0044707
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0009967 [BP]positive regulation of signal transductionprobableGO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009719 [BP]response to endogenous stimulusprobableGO:0050896, GO:0008150
GO:0031410 [CC]cytoplasmic vesicleprobableGO:0005737, GO:0031982, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043226
GO:0045597 [BP]positive regulation of cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0045596 [BP]negative regulation of cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0051716 [BP]cellular response to stimulusprobableGO:0008150, GO:0050896, GO:0009987, GO:0044763, GO:0044699
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0045637 [BP]regulation of myeloid cell differentiationprobableGO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:2000026, GO:0051239, GO:0002682, GO:0050789
GO:0005578 [CC]proteinaceous extracellular matrixprobableGO:0005575, GO:0005576, GO:0044421, GO:0031012
GO:0000904 [BP]cell morphogenesis involved in differentiationprobableGO:0032502, GO:0048856, GO:0000902, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009987, GO:0009653, GO:0044699
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0032991 [CC]macromolecular complexprobableGO:0005575
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YGQ, chain A
Confidence level:very confident
Coverage over the Query: 1-46
View the alignment between query and template
View the model in PyMOL