Diaphorina citri psyllid: psy6698


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MELSTGSSEILSLGRSDSTDSTHSMLHGGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCGDV
cccccccccEEEEccccccccccccccccccEEEEEEEEccccccEEEEEEEEccccccccccccccEEEEEEEEccccEEEEEcccccccccccccccEEEEEEcccccccEEEEEEEEEccccccccEEcEEEEcccccccHHHHHHHHHHHcccccEEEEEcccccc
***************************GGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCG**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELSTGSSEILSLGRSDSTDSTHSMLHGGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCGDV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Synaptotagmin-16 May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues. Is Ca(2+)-independent.confidentQ17RD7
Synaptotagmin-14 May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues. Is Ca(2+)-independent.confidentQ7TN84

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005544 [MF]calcium-dependent phospholipid bindingprobableGO:0043168, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0065007 [BP]biological regulationprobableGO:0008150
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W15, chain A
Confidence level:very confident
Coverage over the Query: 30-168
View the alignment between query and template
View the model in PyMOL