Psyllid ID: psy6698

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
MELSTGSSEILSLGRSDSTDSTHSMLHGGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCGDV
cccccccccEEEEccccccccccccccccccEEEEEEEEccccccEEEEEEEEccccccccccccccEEEEEEEEccccEEEEEcccccccccccccccEEEEEEcccccccEEEEEEEEEccccccccEEcEEEEccccccHHHHHHHHHHHHcccccEEEEEcccccc
cccccccHHHHHHHHHcccccccccccccccEEEEEEEEccccccEEEEEEEEccccccccccccccEEEEEEccccccEEEEEccEEEEcccccccccEEEEEccHHHHcccEEEEEEEEccccccccEEEEEEEccccccccHHHHHHHHHHcccccHHHHHHHHHcc
melstgsseilslgrsdstdsthsmLHGGVAELLLGlsyngttgRIFIEVIKgshfrnvamtraPDTYVKLMLLSSSGQEMSRAKTsvrrgqpnplfkETFVFQVALFHLSDVTLVVSVYDrkslkkkqligwfslgqnstseEELAHWNEMCKVKGEQLARWHILCGDV
melstgsseILSLGRSDSTDSTHSMLHGGVAELLLGLSYNGTTGRIFIEVikgshfrnvaMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCGDV
MELSTGSSEILSLGRSDSTDSTHSMLHGGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCGDV
*************************LHGGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLL*********************LFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCG**
*********************************LLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCG**
*********************THSMLHGGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSS**************GQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCGDV
***STGSSEILSLGRSDS*********GGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCGDV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELSTGSSEILSLGRSDSTDSTHSMLHGGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCGDV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query170 2.2.26 [Sep-21-2011]
Q17RD7645 Synaptotagmin-16 OS=Homo yes N/A 0.911 0.240 0.670 1e-61
Q8NB59555 Synaptotagmin-14 OS=Homo no N/A 0.888 0.272 0.655 3e-57
Q7TN84555 Synaptotagmin-14 OS=Mus m yes N/A 0.882 0.270 0.66 9e-57
Q7TN83639 Synaptotagmin-16 OS=Mus m no N/A 0.964 0.256 0.638 7e-55
Q58G82188 Putative synaptotagmin-14 no N/A 0.876 0.792 0.556 1e-42
Q9H2B2425 Synaptotagmin-4 OS=Homo s no N/A 0.794 0.317 0.333 2e-16
P40749425 Synaptotagmin-4 OS=Mus mu no N/A 0.805 0.322 0.316 7e-16
P50232425 Synaptotagmin-4 OS=Rattus no N/A 0.805 0.322 0.316 8e-16
Q86SS6491 Synaptotagmin-9 OS=Homo s no N/A 0.794 0.274 0.313 8e-15
O43581403 Synaptotagmin-7 OS=Homo s no N/A 0.805 0.339 0.294 2e-14
>sp|Q17RD7|SYT16_HUMAN Synaptotagmin-16 OS=Homo sapiens GN=SYT16 PE=2 SV=2 Back     alignment and function desciption
 Score =  235 bits (599), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 131/155 (84%)

Query: 12  SLGRSDSTDSTHSMLHGGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKL 71
           ++  SDST ST S+ HGG  ELL+GLSYN TTGR+ +E+IKGSHFRN+A+ RAPDTY KL
Sbjct: 488 AVSHSDSTSSTQSLSHGGAPELLVGLSYNATTGRLSVEMIKGSHFRNLAVNRAPDTYGKL 547

Query: 72  MLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLI 131
            LL+S GQEMSR KTS+RRGQPNP++KETFVFQVALF LSDVTL++SVY+R+++K+K++I
Sbjct: 548 FLLNSVGQEMSRCKTSIRRGQPNPVYKETFVFQVALFQLSDVTLMISVYNRRTMKRKEMI 607

Query: 132 GWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHIL 166
           GW +LGQNS+ EEE  HW EM + KG+Q+ RWH L
Sbjct: 608 GWIALGQNSSGEEEQDHWEEMKETKGQQICRWHTL 642
May be involved in the trafficking and exocytosis of secretory vesicles in non-neuronal tissues. Is Ca(2+)-independent.
Homo sapiens (taxid: 9606)
>sp|Q8NB59|SYT14_HUMAN Synaptotagmin-14 OS=Homo sapiens GN=SYT14 PE=1 SV=2 Back     alignment and function description
>sp|Q7TN84|SYT14_MOUSE Synaptotagmin-14 OS=Mus musculus GN=Syt14 PE=2 SV=1 Back     alignment and function description
>sp|Q7TN83|SYT16_MOUSE Synaptotagmin-16 OS=Mus musculus GN=Syt16 PE=1 SV=1 Back     alignment and function description
>sp|Q58G82|SY14L_HUMAN Putative synaptotagmin-14-like protein OS=Homo sapiens GN=SYT14L PE=5 SV=2 Back     alignment and function description
>sp|Q9H2B2|SYT4_HUMAN Synaptotagmin-4 OS=Homo sapiens GN=SYT4 PE=1 SV=1 Back     alignment and function description
>sp|P40749|SYT4_MOUSE Synaptotagmin-4 OS=Mus musculus GN=Syt4 PE=2 SV=2 Back     alignment and function description
>sp|P50232|SYT4_RAT Synaptotagmin-4 OS=Rattus norvegicus GN=Syt4 PE=1 SV=1 Back     alignment and function description
>sp|Q86SS6|SYT9_HUMAN Synaptotagmin-9 OS=Homo sapiens GN=SYT9 PE=2 SV=1 Back     alignment and function description
>sp|O43581|SYT7_HUMAN Synaptotagmin-7 OS=Homo sapiens GN=SYT7 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
91086061 534 PREDICTED: similar to synaptotagmin-14 [ 0.964 0.307 0.690 1e-61
270009912 527 hypothetical protein TcasGA2_TC009236 [T 0.964 0.311 0.690 1e-61
291231106 464 PREDICTED: synaptotagmin VII alpha-like 0.905 0.331 0.679 1e-61
195497030 585 GE25362 [Drosophila yakuba] gi|194182029 0.941 0.273 0.658 4e-61
403264376 645 PREDICTED: synaptotagmin-16 [Saimiri bol 0.911 0.240 0.670 4e-60
109083882 625 PREDICTED: synaptotagmin-16 isoform 1 [M 0.911 0.248 0.670 5e-60
297298018 645 PREDICTED: synaptotagmin-16 isoform 2 [M 0.911 0.240 0.670 5e-60
380817028 645 synaptotagmin-16 [Macaca mulatta] 0.911 0.240 0.670 5e-60
442617322 648 synaptotagmin 14, isoform D [Drosophila 0.941 0.246 0.652 5e-60
126282542 639 PREDICTED: synaptotagmin-16 [Monodelphis 0.964 0.256 0.632 5e-60
>gi|91086061|ref|XP_973912.1| PREDICTED: similar to synaptotagmin-14 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 140/165 (84%), Gaps = 1/165 (0%)

Query: 3   LSTGSSEILSLGRSDSTDSTHSMLHGGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMT 62
           L+  + E+ SL RSDST STHSM HGGV ELLLGL YN TTGR+ IEV+KGSHFRN+A+ 
Sbjct: 367 LTGCAGELTSLARSDSTGSTHSMQHGGVPELLLGLCYNATTGRLSIEVVKGSHFRNLALN 426

Query: 63  RAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDR 122
           RAPDTYVKL L+SS+GQE++ +KT+VRRGQPNPLFKETFVFQVALF L+DVTL+VSVY+R
Sbjct: 427 RAPDTYVKLNLVSSTGQELAHSKTTVRRGQPNPLFKETFVFQVALFQLADVTLMVSVYNR 486

Query: 123 KSL-KKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHIL 166
           K + KKK+++GWFSLG NS+  EELAHW +M + + +Q+ RWHIL
Sbjct: 487 KGVTKKKEMVGWFSLGLNSSGAEELAHWMDMKESQQQQICRWHIL 531

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270009912|gb|EFA06360.1| hypothetical protein TcasGA2_TC009236 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|291231106|ref|XP_002735506.1| PREDICTED: synaptotagmin VII alpha-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|195497030|ref|XP_002095928.1| GE25362 [Drosophila yakuba] gi|194182029|gb|EDW95640.1| GE25362 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|403264376|ref|XP_003924461.1| PREDICTED: synaptotagmin-16 [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|109083882|ref|XP_001099452.1| PREDICTED: synaptotagmin-16 isoform 1 [Macaca mulatta] Back     alignment and taxonomy information
>gi|297298018|ref|XP_001099662.2| PREDICTED: synaptotagmin-16 isoform 2 [Macaca mulatta] gi|355778655|gb|EHH63691.1| hypothetical protein EGM_16707 [Macaca fascicularis] Back     alignment and taxonomy information
>gi|380817028|gb|AFE80388.1| synaptotagmin-16 [Macaca mulatta] Back     alignment and taxonomy information
>gi|442617322|ref|NP_001262249.1| synaptotagmin 14, isoform D [Drosophila melanogaster] gi|440217044|gb|AGB95632.1| synaptotagmin 14, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|126282542|ref|XP_001369323.1| PREDICTED: synaptotagmin-16 [Monodelphis domestica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
FB|FBgn0261086586 Syt14 "Synaptotagmin 14" [Dros 0.941 0.273 0.652 3.6e-57
UNIPROTKB|Q17RD7645 SYT16 "Synaptotagmin-16" [Homo 0.964 0.254 0.644 1.6e-56
UNIPROTKB|F1SRU3471 SYT16 "Uncharacterized protein 0.964 0.348 0.632 2.9e-55
UNIPROTKB|F1NK44400 SYT16 "Uncharacterized protein 0.964 0.41 0.632 4.8e-55
UNIPROTKB|F1MTH9641 SYT16 "Uncharacterized protein 0.964 0.255 0.626 6.1e-55
MGI|MGI:2673872639 Syt16 "synaptotagmin XVI" [Mus 0.964 0.256 0.638 6.1e-55
RGD|1564654484 Syt16 "synaptotagmin XVI" [Rat 0.964 0.338 0.632 1.3e-54
UNIPROTKB|Q8NB59555 SYT14 "Synaptotagmin-14" [Homo 0.888 0.272 0.655 2.7e-52
UNIPROTKB|F1SF52550 SYT14 "Uncharacterized protein 0.888 0.274 0.655 5.6e-52
UNIPROTKB|E1C1Z1555 SYT14 "Uncharacterized protein 0.888 0.272 0.642 7.2e-52
FB|FBgn0261086 Syt14 "Synaptotagmin 14" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 588 (212.0 bits), Expect = 3.6e-57, P = 3.6e-57
 Identities = 105/161 (65%), Positives = 140/161 (86%)

Query:     7 SSEILSLGRSDSTDSTHSMLHGGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPD 66
             +S++LSL RS+S  ST SM HGGV+ELLLGLSYNG TGR+ +E+IKGS FR++++ +APD
Sbjct:   423 TSDLLSLARSESAGSTSSMQHGGVSELLLGLSYNGVTGRLSVEIIKGSQFRSLSLNKAPD 482

Query:    67 TYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLK 126
             TYVK++++SS GQE+SRAKTS+RRGQPNPLFKETF FQVALF L+DVTL++SVY ++ +K
Sbjct:   483 TYVKMVMVSSIGQEISRAKTSIRRGQPNPLFKETFAFQVALFQLNDVTLMISVYAKRHMK 542

Query:   127 KKQLIGWFSLGQNSTSEEELAHWNEMCKV-KGEQLARWHIL 166
             K +++GWFSLG NS+  EE+AHW ++C++ KGE LARWH+L
Sbjct:   543 KNEMVGWFSLGLNSSGSEEVAHWADVCEMPKGEMLARWHVL 583
GO:0005544 "calcium-dependent phospholipid binding" evidence=ISS
GO:0007269 "neurotransmitter secretion" evidence=ISS
GO:0016192 "vesicle-mediated transport" evidence=ISS
GO:0048812 "neuron projection morphogenesis" evidence=IMP
UNIPROTKB|Q17RD7 SYT16 "Synaptotagmin-16" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SRU3 SYT16 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NK44 SYT16 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTH9 SYT16 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2673872 Syt16 "synaptotagmin XVI" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1564654 Syt16 "synaptotagmin XVI" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NB59 SYT14 "Synaptotagmin-14" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SF52 SYT14 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1Z1 SYT14 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7TN84SYT14_MOUSENo assigned EC number0.660.88230.2702yesN/A
Q17RD7SYT16_HUMANNo assigned EC number0.67090.91170.2403yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
cd08408138 cd08408, C2B_Synaptotagmin-14_16, C2 domain second 1e-80
cd00276134 cd00276, C2B_Synaptotagmin, C2 domain second repea 1e-41
cd08405136 cd08405, C2B_Synaptotagmin-7, C2 domain second rep 9e-26
cd08404136 cd08404, C2B_Synaptotagmin-4, C2 domain second rep 9e-24
cd08410135 cd08410, C2B_Synaptotagmin-17, C2 domain second re 7e-22
cd08384133 cd08384, C2B_Rabphilin_Doc2, C2 domain second repe 8e-22
cd08403134 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain s 9e-22
cd08402136 cd08402, C2B_Synaptotagmin-1, C2 domain second rep 7e-19
cd08406136 cd08406, C2B_Synaptotagmin-12, C2 domain second re 1e-18
cd08409137 cd08409, C2B_Synaptotagmin-15, C2 domain second re 3e-17
pfam0016885 pfam00168, C2, C2 domain 1e-15
smart00239101 smart00239, C2, Protein kinase C conserved region 5e-14
cd00030102 cd00030, C2, C2 domain 1e-13
cd08385124 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain 2e-12
cd08390123 cd08390, C2A_Synaptotagmin-15-17, C2A domain first 5e-11
cd08381122 cd08381, C2B_PI3K_class_II, C2 domain second repea 2e-09
cd04030127 cd04030, C2C_KIAA1228, C2 domain third repeat pres 3e-09
cd04020162 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat 7e-09
cd08392128 cd08392, C2A_SLP-3, C2 domain first repeat present 3e-08
cd08521123 cd08521, C2A_SLP, C2 domain first repeat present i 3e-08
cd08407138 cd08407, C2B_Synaptotagmin-13, C2 domain second re 1e-07
cd08389124 cd08389, C2A_Synaptotagmin-14_16, C2A domain first 2e-07
cd08692135 cd08692, C2B_Tac2-N, C2 domain second repeat found 6e-07
cd04029125 cd04029, C2A_SLP-4_5, C2 domain first repeat prese 9e-07
cd04011111 cd04011, C2B_Ferlin, C2 domain second repeat in Fe 3e-06
cd08387124 cd08387, C2A_Synaptotagmin-8, C2A domain first rep 6e-06
cd08393125 cd08393, C2A_SLP-1_2, C2 domain first repeat prese 7e-06
cd00275128 cd00275, C2_PLC_like, C2 domain present in Phospho 2e-05
cd08376116 cd08376, C2B_MCTP_PRT, C2 domain second repeat fou 6e-05
cd08388128 cd08388, C2A_Synaptotagmin-4-11, C2A domain first 9e-05
cd04019150 cd04019, C2C_MCTP_PRT_plant, C2 domain third repea 2e-04
cd08684103 cd08684, C2A_Tac2-N, C2 domain first repeat found 2e-04
cd04026131 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein 3e-04
cd04044124 cd04044, C2A_Tricalbin-like, C2 domain first repea 3e-04
cd08386125 cd08386, C2A_Synaptotagmin-7, C2A domain first rep 4e-04
cd08680124 cd08680, C2_Kibra, C2 domain found in Human protei 6e-04
cd04051125 cd04051, C2_SRC2_like, C2 domain present in Soybea 6e-04
cd04043126 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (ma 8e-04
cd04009133 cd04009, C2B_Munc13-like, C2 domain second repeat 0.001
cd04036119 cd04036, C2_cPLA2, C2 domain present in cytosolic 0.002
COG5038 1227 COG5038, COG5038, Ca2+-dependent lipid-binding pro 0.002
cd08383117 cd08383, C2A_RasGAP, C2 domain (first repeat) of R 0.002
>gnl|CDD|176053 cd08408, C2B_Synaptotagmin-14_16, C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information 
 Score =  234 bits (599), Expect = 1e-80
 Identities = 92/137 (67%), Positives = 117/137 (85%)

Query: 30  VAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVR 89
           V ELLLGL YN  TGR+ +EVIKGS+F+N+AM +APDTYVKL LL+S GQE+S++KTS+R
Sbjct: 1   VPELLLGLEYNALTGRLSVEVIKGSNFKNLAMNKAPDTYVKLTLLNSDGQEISKSKTSIR 60

Query: 90  RGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHW 149
           RGQP+P FKETFVFQVALF LS+VTL+ SVY+++ +K+K++IGWFSLG NS+ EEE  HW
Sbjct: 61  RGQPDPEFKETFVFQVALFQLSEVTLMFSVYNKRKMKRKEMIGWFSLGLNSSGEEEEEHW 120

Query: 150 NEMCKVKGEQLARWHIL 166
           NEM + KG+Q+ RWH L
Sbjct: 121 NEMKESKGQQVCRWHTL 137

Synaptotagmin 14 and 16 are membrane-trafficking proteins in specific tissues outside the brain. Both of these contain C-terminal tandem C2 repeats, but only Synaptotagmin 14 has an N-terminal transmembrane domain and a putative fatty-acylation site. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium and this is indeed the case here. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recycling step of synaptic vesicles. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the second C2 repeat, C2B, and has a type-I topology. Length = 138
>gnl|CDD|175975 cd00276, C2B_Synaptotagmin, C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>gnl|CDD|176050 cd08405, C2B_Synaptotagmin-7, C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176049 cd08404, C2B_Synaptotagmin-4, C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>gnl|CDD|176055 cd08410, C2B_Synaptotagmin-17, C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>gnl|CDD|176030 cd08384, C2B_Rabphilin_Doc2, C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>gnl|CDD|176048 cd08403, C2B_Synaptotagmin-3-5-6-9-10, C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176047 cd08402, C2B_Synaptotagmin-1, C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>gnl|CDD|176051 cd08406, C2B_Synaptotagmin-12, C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>gnl|CDD|176054 cd08409, C2B_Synaptotagmin-15, C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>gnl|CDD|215765 pfam00168, C2, C2 domain Back     alignment and domain information
>gnl|CDD|214577 smart00239, C2, Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>gnl|CDD|175973 cd00030, C2, C2 domain Back     alignment and domain information
>gnl|CDD|176031 cd08385, C2A_Synaptotagmin-1-5-6-9-10, C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>gnl|CDD|176036 cd08390, C2A_Synaptotagmin-15-17, C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>gnl|CDD|176027 cd08381, C2B_PI3K_class_II, C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>gnl|CDD|175996 cd04030, C2C_KIAA1228, C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>gnl|CDD|175987 cd04020, C2B_SLP_1-2-3-4, C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>gnl|CDD|176038 cd08392, C2A_SLP-3, C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>gnl|CDD|176056 cd08521, C2A_SLP, C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>gnl|CDD|176052 cd08407, C2B_Synaptotagmin-13, C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>gnl|CDD|176035 cd08389, C2A_Synaptotagmin-14_16, C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>gnl|CDD|176074 cd08692, C2B_Tac2-N, C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>gnl|CDD|175995 cd04029, C2A_SLP-4_5, C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>gnl|CDD|175978 cd04011, C2B_Ferlin, C2 domain second repeat in Ferlin Back     alignment and domain information
>gnl|CDD|176033 cd08387, C2A_Synaptotagmin-8, C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>gnl|CDD|176039 cd08393, C2A_SLP-1_2, C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|175974 cd00275, C2_PLC_like, C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>gnl|CDD|176022 cd08376, C2B_MCTP_PRT, C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>gnl|CDD|176034 cd08388, C2A_Synaptotagmin-4-11, C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>gnl|CDD|175986 cd04019, C2C_MCTP_PRT_plant, C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>gnl|CDD|176066 cd08684, C2A_Tac2-N, C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>gnl|CDD|175992 cd04026, C2_PKC_alpha_gamma, C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>gnl|CDD|176009 cd04044, C2A_Tricalbin-like, C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>gnl|CDD|176032 cd08386, C2A_Synaptotagmin-7, C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>gnl|CDD|176062 cd08680, C2_Kibra, C2 domain found in Human protein Kibra Back     alignment and domain information
>gnl|CDD|176016 cd04051, C2_SRC2_like, C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>gnl|CDD|176008 cd04043, C2_Munc13_fungal, C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>gnl|CDD|175976 cd04009, C2B_Munc13-like, C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>gnl|CDD|176001 cd04036, C2_cPLA2, C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>gnl|CDD|227371 COG5038, COG5038, Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|176029 cd08383, C2A_RasGAP, C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 170
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 100.0
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 100.0
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 100.0
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 100.0
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 100.0
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 99.98
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 99.97
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 99.97
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 99.97
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 99.97
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 99.97
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 99.97
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 99.97
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 99.95
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 99.95
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 99.95
KOG1028|consensus421 99.95
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 99.95
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 99.94
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 99.94
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 99.94
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 99.93
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 99.93
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 99.93
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 99.93
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 99.92
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 99.92
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 99.92
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 99.92
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 99.91
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 99.91
KOG0696|consensus 683 99.9
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 99.88
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 99.87
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 99.86
KOG1028|consensus 421 99.86
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 99.85
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 99.84
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.83
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 99.8
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 99.79
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 99.79
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 99.79
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 99.79
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 99.78
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.77
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 99.76
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 99.76
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 99.76
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 99.76
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 99.76
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 99.76
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 99.75
KOG1030|consensus168 99.75
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 99.74
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 99.74
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 99.74
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 99.74
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 99.74
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 99.73
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 99.73
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 99.73
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 99.73
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 99.72
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 99.72
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 99.72
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 99.72
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 99.72
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 99.71
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 99.71
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 99.71
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 99.71
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 99.7
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 99.7
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 99.7
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 99.7
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.68
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 99.68
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 99.67
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 99.67
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 99.67
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 99.66
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 99.66
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 99.66
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 99.65
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 99.65
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 99.64
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 99.63
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 99.62
KOG1013|consensus362 99.62
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 99.62
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 99.6
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 99.59
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 99.57
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 99.57
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 99.57
KOG1011|consensus1283 99.56
KOG0905|consensus1639 99.51
PLN03008 868 Phospholipase D delta 99.44
KOG1011|consensus 1283 99.44
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 99.4
cd08684103 C2A_Tac2-N C2 domain first repeat found in Tac2-N 99.36
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 99.36
KOG1328|consensus1103 99.36
PLN032002102 cellulose synthase-interactive protein; Provisiona 99.34
cd00030102 C2 C2 domain. The C2 domain was first identified i 99.33
PLN02223537 phosphoinositide phospholipase C 99.26
KOG2059|consensus 800 99.22
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 99.18
PLN02952599 phosphoinositide phospholipase C 99.16
PLN02230598 phosphoinositide phospholipase C 4 99.16
PLN02222581 phosphoinositide phospholipase C 2 99.08
KOG0169|consensus746 99.04
PLN02228567 Phosphoinositide phospholipase C 99.01
KOG1328|consensus 1103 98.91
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 98.9
KOG1013|consensus 362 98.9
PLN02270 808 phospholipase D alpha 98.89
KOG2060|consensus405 98.82
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 98.82
KOG1264|consensus1267 98.74
KOG2059|consensus 800 98.73
KOG1031|consensus 1169 98.72
KOG1326|consensus 1105 98.53
cd08683143 C2_C2cd3 C2 domain found in C2 calcium-dependent d 98.24
KOG1327|consensus 529 98.13
PLN02352 758 phospholipase D epsilon 98.01
PLN02964 644 phosphatidylserine decarboxylase 97.89
KOG1326|consensus 1105 97.51
cd08693173 C2_PI3K_class_I_beta_delta C2 domain present in cl 97.44
cd08398158 C2_PI3K_class_I_alpha C2 domain present in class I 97.41
cd08380156 C2_PI3K_like C2 domain present in phosphatidylinos 97.37
cd08397159 C2_PI3K_class_III C2 domain present in class III p 97.34
cd04012171 C2A_PI3K_class_II C2 domain first repeat present i 97.07
KOG1265|consensus 1189 97.05
cd08399178 C2_PI3K_class_I_gamma C2 domain present in class I 96.88
cd08695189 C2_Dock-B C2 domains found in Dedicator Of CytoKin 96.82
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 96.76
PF12416 340 DUF3668: Cep120 protein; InterPro: IPR022136 This 96.73
PF00792142 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: I 96.63
smart00142100 PI3K_C2 Phosphoinositide 3-kinase, region postulat 96.63
cd08694196 C2_Dock-A C2 domains found in Dedicator Of CytoKin 96.55
KOG3837|consensus523 96.04
PF15627156 CEP76-C2: CEP76 C2 domain 95.59
cd08679178 C2_DOCK180_related C2 domains found in Dedicator O 94.76
PF10358143 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; 94.5
cd08697185 C2_Dock-D C2 domains found in Dedicator Of CytoKin 94.14
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 93.18
cd08696179 C2_Dock-C C2 domains found in Dedicator Of CytoKin 92.18
KOG1452|consensus 442 84.88
cd0868798 C2_PKN-like C2 domain in Protein kinase C-like (PK 84.18
KOG0906|consensus 843 82.83
KOG1327|consensus 529 81.07
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information 
Probab=100.00  E-value=6.3e-35  Score=197.84  Aligned_cols=135  Identities=26%  Similarity=0.445  Sum_probs=125.1

Q ss_pred             ccEEEEEEEEeCCCCeEEEEEEEeecCCCCCC--CCCCCcEEEEEEEeCCCCccceeeecceeCCCCCeeeeeEEEEeec
Q psy6698          30 VAELLLGLSYNGTTGRIFIEVIKGSHFRNVAM--TRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVAL  107 (170)
Q Consensus        30 ~G~l~~~l~~~~~~~~L~v~i~~a~~L~~~~~--~~~~~p~v~~~l~~~~~~~~~~~~t~~~~~t~~p~~~e~~~f~~~~  107 (170)
                      .|+|.++++|.+..++|+|.|++|+||+..+.  .+.+||||++++.++ +++..+++|++++++.||+|||+|.|.++.
T Consensus         1 ~Gel~~sL~Y~~~~~~L~V~V~karnL~~~d~~~~~~~DpYVKv~l~~~-~~k~~kkkT~v~k~t~nPvfNE~f~F~v~~   79 (138)
T cd08407           1 TGEVLLSISYLPAANRLLVVVIKAKNLHSDQLKLLLGIDVSVKVTLKHQ-NAKLKKKQTKRAKHKINPVWNEMIMFELPS   79 (138)
T ss_pred             CCEEEEEEEEeCCCCeEEEEEEEecCCCccccCCCCCCCeEEEEEEEcC-CcccceeccceeeCCCCCccccEEEEECCH
Confidence            48999999999999999999999999999873  345899999999985 556678899999999999999999999999


Q ss_pred             CCccceEEEEEEEeCCCCCCcceeEEEEEcCCCCChHHHHHHHHHhhcCCCeeeecccc
Q psy6698         108 FHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHIL  166 (170)
Q Consensus       108 ~~l~~~~l~i~v~~~~~~~~~~~iG~~~i~l~~~~~~~~~~W~~l~~~~~~~~~~w~~l  166 (170)
                      +++.+..|.|.||+++.++++++||++.+++.+.+. +..||.+|+.+|++++++||.|
T Consensus        80 ~~L~~~~L~~~V~d~d~~~~~d~iG~v~lg~~~~g~-~~~hW~~ml~~p~~~va~WH~L  137 (138)
T cd08407          80 ELLAASSVELEVLNQDSPGQSLPLGRCSLGLHTSGT-ERQHWEEMLDNPRRQIAMWHQL  137 (138)
T ss_pred             HHhCccEEEEEEEeCCCCcCcceeceEEecCcCCCc-HHHHHHHHHhCCCCchhEEEEC
Confidence            888888999999999999999999999999998887 8899999999999999999987

Synaptotagmin is a membrane-trafficking protein characterized by a N-terminal transmembrane region, a linker, and 2 C-terminal C2 domains. Synaptotagmin 13, a member of class 6 synaptotagmins, is located in the brain. It functions are unknown. It, like synaptotagmins 8 and 12, does not have any consensus Ca2+ binding sites. Previously all synaptotagmins were thought to be calcium sensors in the regulation of neurotransmitter release and hormone secretion, but it has been shown that not all of them bind calcium. Of the 17 identified synaptotagmins only 8 bind calcium (1-3, 5-7, 9, 10). The function of the two C2 domains that bind calcium are: regulating the fusion step of synaptic vesicle exocytosis (C2A) and binding to phosphatidyl-inositol-3,4,5-triphosphate (PIP3) in the absence of calcium ions and to phosphatidylinositol bisphosphate (PIP2) in their presence (C2B). C2B also regulates also the recy
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>KOG1028|consensus Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>KOG1028|consensus Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>KOG1030|consensus Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>KOG1013|consensus Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>KOG1011|consensus Back     alignment and domain information
>KOG0905|consensus Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>KOG1011|consensus Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08684 C2A_Tac2-N C2 domain first repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>KOG1328|consensus Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG1328|consensus Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>KOG1013|consensus Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>KOG2060|consensus Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>KOG1031|consensus Back     alignment and domain information
>KOG1326|consensus Back     alignment and domain information
>cd08683 C2_C2cd3 C2 domain found in C2 calcium-dependent domain containing 3 (C2cd3) proteins Back     alignment and domain information
>KOG1327|consensus Back     alignment and domain information
>PLN02352 phospholipase D epsilon Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG1326|consensus Back     alignment and domain information
>cd08693 C2_PI3K_class_I_beta_delta C2 domain present in class I beta and delta phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08398 C2_PI3K_class_I_alpha C2 domain present in class I alpha phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08380 C2_PI3K_like C2 domain present in phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08397 C2_PI3K_class_III C2 domain present in class III phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd04012 C2A_PI3K_class_II C2 domain first repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>KOG1265|consensus Back     alignment and domain information
>cd08399 C2_PI3K_class_I_gamma C2 domain present in class I gamma phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08695 C2_Dock-B C2 domains found in Dedicator Of CytoKinesis (Dock) class B proteins Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>PF12416 DUF3668: Cep120 protein; InterPro: IPR022136 This domain family is found in eukaryotes, and is typically between 75 and 114 amino acids in length Back     alignment and domain information
>PF00792 PI3K_C2: Phosphoinositide 3-kinase C2; InterPro: IPR002420 Phosphatidylinositol 3-kinase (PI3-kinase) (2 Back     alignment and domain information
>smart00142 PI3K_C2 Phosphoinositide 3-kinase, region postulated to contain C2 domain Back     alignment and domain information
>cd08694 C2_Dock-A C2 domains found in Dedicator Of CytoKinesis (Dock) class A proteins Back     alignment and domain information
>KOG3837|consensus Back     alignment and domain information
>PF15627 CEP76-C2: CEP76 C2 domain Back     alignment and domain information
>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins Back     alignment and domain information
>PF10358 NT-C2: N-terminal C2 in EEIG1 and EHBP1 proteins; InterPro: IPR019448 This entry represents the N-terminal 150 residues of a family of conserved proteins which are induced by oestrogen [] Back     alignment and domain information
>cd08697 C2_Dock-D C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>cd08696 C2_Dock-C C2 domains found in Dedicator Of CytoKinesis (Dock) class C proteins Back     alignment and domain information
>KOG1452|consensus Back     alignment and domain information
>cd08687 C2_PKN-like C2 domain in Protein kinase C-like (PKN) proteins Back     alignment and domain information
>KOG0906|consensus Back     alignment and domain information
>KOG1327|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
1w15_A153 Rat Synaptotagmin 4 C2b Domain In The Presence Of C 1e-16
1dqv_A296 Crystal Structure Of Synaptotagmin Iii C2aC2B Lengt 3e-14
3hn8_A296 Crystal Structure Of Synaptotagmin Length = 296 3e-14
3n5a_A138 Synaptotagmin-7, C2b-Domain, Calcium Bound Length = 5e-14
2cm5_A166 Crystal Structure Of The C2b Domain Of Rabphilin Le 4e-12
2cm6_A166 Crystal Structure Of The C2b Domain Of Rabphilin3a 5e-12
3rpb_A140 The C2b-Domain Of Rabphilin: Structural Variations 5e-12
1tjm_A159 Crystallographic Identification Of Sr2+ Coordinatio 1e-11
1k5w_A152 Three-Dimensional Structure Of The Synaptotagmin 1 2e-11
2lha_A151 Solution Structure Of C2b With Ip6 Length = 151 2e-11
2r83_A284 Crystal Structure Analysis Of Human Synaptotagmin 1 2e-11
3f04_A143 Crystal Structure Of Synaptotagmin I C2a Domain Len 2e-09
1rsy_A152 Structure Of The First C2-domain Of Synaptotagmin I 2e-09
3f00_A143 Crystal Structure Of Synaptotagmin I C2a Domain Wit 2e-09
1byn_A128 Solution Structure Of The Calcium-Bound First C2-Do 2e-09
>pdb|1W15|A Chain A, Rat Synaptotagmin 4 C2b Domain In The Presence Of Calcium Length = 153 Back     alignment and structure 
Iteration: 1

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 71/137 (51%), Gaps = 2/137 (1%)
Query: 31  AELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRR 90
            ELL+ L Y  TT  + + V+K  H     ++   D YVK+ L  +  + +S+ KT V++
Sbjct: 17  GELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAK-KRISKKKTHVKK 75
Query: 91  GQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWN 150
             PN +F E FVF +    L ++++   V D +   + ++IG   LG  +       HW 
Sbjct: 76  CTPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEGSGG-GHWK 134
Query: 151 EMCKVKGEQLARWHILC 167
           E+C     Q+A+WH+LC
Sbjct: 135 EICDFPRRQIAKWHMLC 151
>pdb|1DQV|A Chain A, Crystal Structure Of Synaptotagmin Iii C2aC2B Length = 296 Back     alignment and structure
>pdb|3HN8|A Chain A, Crystal Structure Of Synaptotagmin Length = 296 Back     alignment and structure
>pdb|3N5A|A Chain A, Synaptotagmin-7, C2b-Domain, Calcium Bound Length = 138 Back     alignment and structure
>pdb|2CM5|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin Length = 166 Back     alignment and structure
>pdb|2CM6|A Chain A, Crystal Structure Of The C2b Domain Of Rabphilin3a Length = 166 Back     alignment and structure
>pdb|3RPB|A Chain A, The C2b-Domain Of Rabphilin: Structural Variations In A Janus-Faced Domain Length = 140 Back     alignment and structure
>pdb|1TJM|A Chain A, Crystallographic Identification Of Sr2+ Coordination Site In Synaptotagmin I C2b Domain Length = 159 Back     alignment and structure
>pdb|1K5W|A Chain A, Three-Dimensional Structure Of The Synaptotagmin 1 C2b- Domain: Synaptotagmin 1 As A Phospholipid Binding Machine Length = 152 Back     alignment and structure
>pdb|2LHA|A Chain A, Solution Structure Of C2b With Ip6 Length = 151 Back     alignment and structure
>pdb|2R83|A Chain A, Crystal Structure Analysis Of Human Synaptotagmin 1 C2a-c2b Length = 284 Back     alignment and structure
>pdb|3F04|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain Length = 143 Back     alignment and structure
>pdb|1RSY|A Chain A, Structure Of The First C2-domain Of Synaptotagmin I: A Novel Ca2+(slash)phospholipid Binding Fold Length = 152 Back     alignment and structure
>pdb|3F00|A Chain A, Crystal Structure Of Synaptotagmin I C2a Domain With Cu(Ii) Length = 143 Back     alignment and structure
>pdb|1BYN|A Chain A, Solution Structure Of The Calcium-Bound First C2-Domain Of Synaptotagmin I Length = 128 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 2e-49
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 6e-48
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 9e-47
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 9e-47
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 3e-45
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 2e-21
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 4e-42
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 1e-20
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 4e-34
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 9e-24
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 2e-21
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 5e-21
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 7e-21
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 3e-20
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 1e-19
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 7e-19
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 1e-18
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 2e-18
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 3e-18
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 7e-18
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 9e-18
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 2e-17
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 1e-16
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 2e-15
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 3e-14
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 4e-14
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 5e-13
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 3e-12
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 2e-09
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 6e-09
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 1e-08
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 1e-07
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 2e-07
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 6e-07
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 1e-06
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 4e-06
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 6e-06
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 3e-05
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 4e-05
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 8e-05
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 7e-04
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Length = 166 Back     alignment and structure
 Score =  156 bits (395), Expect = 2e-49
 Identities = 44/162 (27%), Positives = 78/162 (48%), Gaps = 4/162 (2%)

Query: 6   GSSEILSLGRSDSTDSTHSMLHGGVAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAP 65
           GS+  ++L   +  +    +   G  ++L+ L Y+   G + + +I+  H   +      
Sbjct: 1   GSARGMALYEEEQVERIGDIEERG--KILVSLMYSTQQGGLIVGIIRCVHLAAMDANGYS 58

Query: 66  DTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSL 125
           D +VKL L    G++ ++ KT +++   NP F E F + +    L+  +L +SV+D    
Sbjct: 59  DPFVKLWLKPDMGKK-AKHKTQIKKKTLNPEFNEEFFYDIKHSDLAKKSLDISVWDYDIG 117

Query: 126 KKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILC 167
           K    IG   LG ++   E L HW E  K K +++ RWH L 
Sbjct: 118 KSNDYIGGCQLGISAKG-ERLKHWYECLKNKDKKIERWHQLQ 158
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Length = 153 Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Length = 138 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Length = 159 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Length = 296 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Length = 284 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Length = 155 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Length = 148 Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Length = 152 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 142 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Length = 143 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 141 Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Length = 149 Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Length = 138 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Length = 129 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 147 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Length = 142 Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} Length = 153 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Length = 134 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Length = 171 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Length = 142 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Length = 176 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Length = 153 Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Length = 173 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Length = 136 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Length = 132 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Length = 126 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Length = 157 Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} PDB: 3kwt_A* Length = 148 Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Length = 136 Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Length = 133 Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Length = 749 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Length = 624 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 100.0
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 100.0
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 99.98
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 99.97
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.95
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 99.94
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.94
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 99.94
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 99.93
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 99.93
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 99.93
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 99.93
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 99.93
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 99.93
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 99.92
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.92
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 99.92
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 99.92
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 99.92
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 99.91
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 99.91
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 99.91
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 99.9
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 99.89
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 99.88
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 99.85
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 99.81
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.81
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 99.81
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.8
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.79
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.79
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 99.79
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 99.76
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.75
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 99.73
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 99.7
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.66
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.63
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 99.6
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 99.59
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 99.58
3nsj_A540 Perforin-1; pore forming protein, immune system; H 99.57
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.57
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 99.55
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 99.33
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 99.2
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.18
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 99.14
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 98.35
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 98.27
3l4c_A220 Dedicator of cytokinesis protein 1; DOCK180, DOCK1 97.28
2wxf_A 940 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 95.66
3hhm_A 1091 Phosphatidylinositol-4,5-bisphosphate 3-kinase cat 94.7
1e7u_A 961 Phosphatidylinositol 3-kinase catalytic subunit; p 94.13
2y3a_A 1092 Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca 91.03
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=5.9e-32  Score=183.13  Aligned_cols=137  Identities=29%  Similarity=0.594  Sum_probs=126.2

Q ss_pred             ccEEEEEEEEeCCCCeEEEEEEEeecCCCCCCCCCCCcEEEEEEEeCCCCccceeeecceeCCCCCeeeeeEEEEeecCC
Q psy6698          30 VAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFH  109 (170)
Q Consensus        30 ~G~l~~~l~~~~~~~~L~v~i~~a~~L~~~~~~~~~~p~v~~~l~~~~~~~~~~~~t~~~~~t~~p~~~e~~~f~~~~~~  109 (170)
                      +|+|.+++.|....+.|.|.|++|++|+..+..+.+|||+++++.++ +.....++|++++++.||.|||+|.|.+...+
T Consensus         2 ~G~l~~sl~y~~~~~~L~v~v~~a~~L~~~d~~g~~dpyv~v~~~~~-~~~~~~~kT~~~~~t~nP~wne~f~f~v~~~~   80 (138)
T 3n5a_A            2 RGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYK-DKRVEKKKTVTKKRNLNPIFNESFAFDIPTEK   80 (138)
T ss_dssp             CCEEEEEEEEETTTTEEEEEEEEEESCCCCBTTTBCCEEEEEEEEET-TEEEEEEECCCCSSCSSCEEEEEEEEECCGGG
T ss_pred             CcEEEEEEEEcCCCCeEEEEEEEeeCCCCcCCCCCcCeEEEEEEEeC-CCccceEeCccccCCCCCcCcceEEEECChhh
Confidence            69999999999999999999999999999988889999999999874 33456789999999999999999999998877


Q ss_pred             ccceEEEEEEEeCCCCCCcceeEEEEEcCCCCChHHHHHHHHHhhcCCCeeeecccccc
Q psy6698         110 LSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCG  168 (170)
Q Consensus       110 l~~~~l~i~v~~~~~~~~~~~iG~~~i~l~~~~~~~~~~W~~l~~~~~~~~~~w~~l~~  168 (170)
                      +.+..|.|.|||++.++++++||++.+++++... +..+|++|+..|++++++||+|.+
T Consensus        81 l~~~~l~~~V~d~~~~~~~~~lG~~~i~l~~~~~-~~~~W~~l~~~~~~~~~~Wh~L~p  138 (138)
T 3n5a_A           81 LRETTIIITVMDKDKLSRNDVIGKIYLSWKSGPG-EVKHWKDMIARPRQPVAQWHQLKA  138 (138)
T ss_dssp             GGGEEEEEEEEECCSSSCCEEEEEEEESSSSCHH-HHHHHHHHHHSTTCCEEEEEECBC
T ss_pred             cCceEEEEEEEECCCCCCCcEEEEEEEccccCCh-HHHHHHHHHhCCCCeEEEEeecCC
Confidence            7778999999999999999999999999998766 899999999999999999999975
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3l4c_A Dedicator of cytokinesis protein 1; DOCK180, DOCK1, phosphoinositide specificity, guanine exchan factor, RHO GTPase, cytoskeleton, cell migration; 2.37A {Homo sapiens} Back     alignment and structure
>2wxf_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit delta isoform; transferase, phosphoprotein, isoform-specific inhibitors; HET: 039; 1.90A {Mus musculus} PDB: 2wxg_A* 2wxh_A* 2wxi_A* 2wxj_A* 2wxk_A* 2wxl_A* 2wxm_A* 2wxn_A* 2wxo_A* 2wxp_A* 2wxq_A* 2wxr_A 2x38_A* Back     alignment and structure
>3hhm_A Phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha isoform; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_A 2rd0_A 4a55_A* 2enq_A Back     alignment and structure
>2y3a_A Phosphatidylinositol-4,5-bisphosphate 3-kinase Ca subunit beta isoform; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 170
d1w15a_138 b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegi 1e-32
d2cm5a1137 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat ( 5e-29
d1uowa_157 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 1e-27
d1dqva2145 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus 3e-27
d2bwqa1125 b.7.1.2 (A:729-853) Regulating synaptic membrane e 4e-19
d1rsya_143 b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicu 5e-18
d1a25a_132 b.7.1.2 (A:) C2 domain from protein kinase c (beta 1e-14
d1wfma_138 b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapie 4e-14
d1ugka_138 b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens 1e-12
d1dqva1130 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus 2e-11
d1qasa2131 b.7.1.1 (A:626-756) PI-specific phospholipase C is 3e-11
d1rh8a_142 b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [Tax 6e-11
d2zkmx2122 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human 2e-06
d1wfja_136 b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cr 1e-05
d2nq3a1133 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itc 0.001
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure

class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: Synaptotagmin IV
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  111 bits (278), Expect = 1e-32
 Identities = 43/136 (31%), Positives = 71/136 (52%), Gaps = 2/136 (1%)

Query: 32  ELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRG 91
           ELL+ L Y  TT  + + V+K  H     ++   D YVK+ L  +  + +S+ KT V++ 
Sbjct: 3   ELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHAK-KRISKKKTHVKKC 61

Query: 92  QPNPLFKETFVFQVALFHLSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNE 151
            PN +F E FVF +    L ++++   V D +   + ++IG   LG  +       HW E
Sbjct: 62  TPNAVFNELFVFDIPCESLEEISVEFLVLDSERGSRNEVIGRLVLGATAEG-SGGGHWKE 120

Query: 152 MCKVKGEQLARWHILC 167
           +C     Q+A+WH+LC
Sbjct: 121 ICDFPRRQIAKWHMLC 136
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 137 Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 157 Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 143 Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 132 Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Length = 138 Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 130 Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 131 Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 142 Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 136 Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 100.0
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 100.0
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 100.0
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 100.0
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 99.93
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 99.93
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 99.93
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 99.92
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 99.92
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 99.92
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 99.91
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 99.81
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.77
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 99.75
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 99.73
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 99.71
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 99.71
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.64
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 99.47
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 99.44
d1e7ua2174 Phoshoinositide 3-kinase (PI3K) {Pig (Sus scrofa) 96.85
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: Synaptotagmin-like (S variant)
domain: Synaptotagmin IV
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=2.8e-33  Score=188.41  Aligned_cols=137  Identities=31%  Similarity=0.631  Sum_probs=121.3

Q ss_pred             ccEEEEEEEEeCCCCeEEEEEEEeecCCCCCCCCCCCcEEEEEEEeCCCCccceeeecceeCCCCCeeeeeEEEEeecCC
Q psy6698          30 VAELLLGLSYNGTTGRIFIEVIKGSHFRNVAMTRAPDTYVKLMLLSSSGQEMSRAKTSVRRGQPNPLFKETFVFQVALFH  109 (170)
Q Consensus        30 ~G~l~~~l~~~~~~~~L~v~i~~a~~L~~~~~~~~~~p~v~~~l~~~~~~~~~~~~t~~~~~t~~p~~~e~~~f~~~~~~  109 (170)
                      +|+|+++++|++..++|.|.|++|+||+..+..+.+||||++++.++ +....+++|++++++.+|.|||+|.|.+...+
T Consensus         1 rG~l~~sl~Y~~~~~~L~V~v~~a~~L~~~~~~~~~dpyvkv~l~~~-~~~~~~~kT~~~~~t~~P~wne~f~F~v~~~~   79 (138)
T d1w15a_           1 RGELLVSLCYQSTTNTLTVVVLKARHLPKSDVSGLSDPYVKVNLYHA-KKRISKKKTHVKKCTPNAVFNELFVFDIPCES   79 (138)
T ss_dssp             CCEEEEEEEEETTTTEEEEEEEEEESCC------CCCEEEEEEEEET-TEEEEEEECCCCCSCSSEEEEEEEEEECCSSS
T ss_pred             CcEEEEEEEEcCCCCEEEEEEEEeECCCCCCCCCCcCEEEEEEEeCC-cccCccccceeECCCCCCeECcEEEEEecHHH
Confidence            59999999999999999999999999999988889999999999874 44556788999999999999999999998888


Q ss_pred             ccceEEEEEEEeCCCCCCcceeEEEEEcCCCCChHHHHHHHHHhhcCCCeeeecccccc
Q psy6698         110 LSDVTLVVSVYDRKSLKKKQLIGWFSLGQNSTSEEELAHWNEMCKVKGEQLARWHILCG  168 (170)
Q Consensus       110 l~~~~l~i~v~~~~~~~~~~~iG~~~i~l~~~~~~~~~~W~~l~~~~~~~~~~w~~l~~  168 (170)
                      +....|.|.|||++.++++++||++.|++.+.+. +..||++|+..|++++++||+|..
T Consensus        80 ~~~~~l~i~v~d~~~~~~~~~iG~~~i~l~~~~~-~~~hW~~ll~~~~k~i~~Wh~L~~  137 (138)
T d1w15a_          80 LEEISVEFLVLDSERGSRNEVIGRLVLGATAEGS-GGGHWKEICDFPRRQIAKWHMLCD  137 (138)
T ss_dssp             STTEEEEEEEEECCTTSCCEEEEEEEESTTCCSH-HHHHHHHHHHSTTCCEEEEEECBC
T ss_pred             hCccEEEEEEEeCCCCCCCCEEEEEEEcchhCCc-hHHHHHHHHhCCCCeeeECeEccc
Confidence            8888999999999999999999999999998876 889999999999999999999963
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure