Diaphorina citri psyllid: psy6704

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--

MESDIDVVGDEVKINKLSIRDKMLLKRNFNRLRHSENFQAGRVIEDPGGSPSHTGLHDGKSFTFWALIGLLYLFALINLVLTLTLMTMLRIGWGMETIEMLPLLNMVKLYGDIDLGKLYKDDGYFSSFKDSGLRITGRQGGSVHIDVNFGVNRTRRMLSIEPEGVRVTNVKEFNVYDPTDHLPIFSTGFRSADFGLPRGVKKLDVQQVRTSRIISPIEDDLTLRSETYTRLKGNEGISMEGRTITWTADKDIFLKSVNGSLTLAAENGIFLEVKKLPFVKKNLFLDSNLHNAAFKLCVCMPGGRIFRVKADDIMSHNACHNINTSPEHHPCR

cccccccccccccccccccHHHHHHHHHHcccccccccccCEECcccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccEEEEEEcccEEEEEcCECcCEEEEccccEECcccccEEEEEccccEEEEEEEcccccCEEEEEEccccEEEEEEcEEEEEcccccccEEEEcccccCCccccccccEEEEEEEEccEEccccccEEEECccEEEEEcccCEEEEEcEEEEEEcccEEEEEcccEEEEEEcccEEEEcccccccccccccccccccEEEEEEEEccccEEEEEEccccccccccccccccccccccc

**SDIDVVGDEVKINKLSIRDKMLL************F***RV***********GLHDGKSFTFWALIGLLYLFALINLVLTLTLMTMLRIGWGMETIEMLPLLNMVKLYGDIDLGKLYKDDGYFSSFKDSGLRITGRQGGSVHIDVNFGVNRTRRMLSIEPEGVRVTNVKEFNVYDPTDHLPIFSTGFRSADFGLPRGVKKLDVQQVRTSRIISPIEDDLTLRSETYTRLKGNEGISMEGRTITWTADKDIFLKSVNGSLTLAAENGIFLEVKKLPFVKKNLFLDSNLHNAAFKLCVCMPGGRIFRVKADDIMSHNACHNINT********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Beta-sarcoglycan	Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.	confident	Q28635
Beta-sarcoglycan	Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.	confident	Q16585
Beta-sarcoglycan	Component of the sarcoglycan complex, a subcomplex of the dystrophin-glycoprotein complex which forms a link between the F-actin cytoskeleton and the extracellular matrix.	confident	Q5R9U1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0042383 [CC]	sarcolemma	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0044699 [BP]	single-organism process	probable	GO:0008150
GO:0016010 [CC]	dystrophin-associated glycoprotein complex	probable	GO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted