Diaphorina citri psyllid: psy6706

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MGRIFLDHIGGSRLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWVYEFALEETQRYKEGRVILERALVTESDVKILDLGSQ
cccccccccccccEEEcccccccccccccEEEcccccccccEEEEEEEEEccccccccEEEEEccCEEEEEEcccccccEEEEEcccccccccEEccEEEEEEcccccccccccccccc
MGRIFLDHIGGSRLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWVYEFALEETQRYKEGRVILERALVTESDVK*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRIFLDHIGGSRLFSCAACDTILTNRRELISTRFTGATGRAFLFHRVVNLNYSDVQDRVMLTGRHMVRDVSCKNCNTKLGWVYEFALEETQRYKEGRVILERALVTESDVKILDLGSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein yippee very confidentQ9XZF0
Protein yippee-like 5 very confidentP62699
Protein yippee-like 5 very confidentQ3ZBE7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0033743 [MF]peptide-methionine (R)-S-oxide reductase activityprobableGO:0003824, GO:0016671, GO:0003674, GO:0016667, GO:0016491
GO:0051898 [BP]negative regulation of protein kinase B signaling cascadeprobableGO:0009968, GO:0050794, GO:0009966, GO:0048585, GO:0048583, GO:0010741, GO:0050789, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0010627, GO:0051896, GO:0048523
GO:0031641 [BP]regulation of myelinationprobableGO:0051239, GO:0044057, GO:0031644, GO:0032844, GO:0008150, GO:0050793, GO:2000021, GO:2000026, GO:0051960, GO:0023051, GO:0065007, GO:0051969, GO:0010646, GO:0050789, GO:0050794
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007476 [BP]imaginal disc-derived wing morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0035220, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007472, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0035114, GO:0008150, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CXK, chain A
Confidence level:confident
Coverage over the Query: 12-85
View the alignment between query and template
View the model in PyMOL
Template: 3EQT, chain A
Confidence level:probable
Coverage over the Query: 8-106
View the alignment between query and template
View the model in PyMOL